Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 186038..186557 | Replicon | chromosome |
| Accession | NZ_CP120948 | ||
| Organism | Burkholderia contaminans strain 5080 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A1E3FLI5 |
| Locus tag | P4E65_RS18460 | Protein ID | WP_039349649.1 |
| Coordinates | 186276..186557 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A4V2WFY1 |
| Locus tag | P4E65_RS18455 | Protein ID | WP_039349647.1 |
| Coordinates | 186038..186286 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P4E65_RS18445 (P4E65_18445) | 183470..184660 | + | 1191 | WP_039349643.1 | 2-methylaconitate cis-trans isomerase PrpF | - |
| P4E65_RS18450 (P4E65_18450) | 184844..185896 | + | 1053 | WP_039349645.1 | CaiB/BaiF CoA-transferase family protein | - |
| P4E65_RS18455 (P4E65_18455) | 186038..186286 | + | 249 | WP_039349647.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| P4E65_RS18460 (P4E65_18460) | 186276..186557 | + | 282 | WP_039349649.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P4E65_RS18465 (P4E65_18465) | 186675..187118 | - | 444 | WP_011353771.1 | PaaI family thioesterase | - |
| P4E65_RS18470 (P4E65_18470) | 187388..189007 | + | 1620 | WP_039349654.1 | methyl-accepting chemotaxis protein | - |
| P4E65_RS18475 (P4E65_18475) | 188980..190089 | - | 1110 | WP_039349656.1 | AGE family epimerase/isomerase | - |
| P4E65_RS18480 (P4E65_18480) | 190203..190901 | + | 699 | WP_039349658.1 | MgtC/SapB family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10986.88 Da Isoelectric Point: 10.7091
>T275469 WP_039349649.1 NZ_CP120948:186276-186557 [Burkholderia contaminans]
MTFELAFLEPALKEWKKLDRTVRDQFKSRLAERLENPRIPSAKLQGHPDRYKIKLRSVGYRLVYEVRDSEVLVLVVAVGR
RERDAVYLAAMKR
MTFELAFLEPALKEWKKLDRTVRDQFKSRLAERLENPRIPSAKLQGHPDRYKIKLRSVGYRLVYEVRDSEVLVLVVAVGR
RERDAVYLAAMKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1E3FLI5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4V2WFY1 |