Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RHH(antitoxin)
Location 1933081..1933611 Replicon chromosome
Accession NZ_CP120947
Organism Burkholderia contaminans strain 5080

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag P4E65_RS08890 Protein ID WP_232490759.1
Coordinates 1933372..1933611 (+) Length 80 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID -
Locus tag P4E65_RS08885 Protein ID WP_076841742.1
Coordinates 1933081..1933326 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P4E65_RS08850 (P4E65_08850) 1928146..1929162 + 1017 WP_039358635.1 GNAT family N-acetyltransferase -
P4E65_RS08855 (P4E65_08855) 1929412..1929678 + 267 WP_046196769.1 type II toxin-antitoxin system VapB family antitoxin -
P4E65_RS08860 (P4E65_08860) 1929675..1929836 + 162 WP_223274361.1 type II toxin-antitoxin system VapC family toxin -
P4E65_RS08865 (P4E65_08865) 1929864..1930091 + 228 WP_223274360.1 hypothetical protein -
P4E65_RS08870 (P4E65_08870) 1930140..1930379 - 240 Protein_1726 nucleotidyltransferase -
P4E65_RS08875 (P4E65_08875) 1930393..1931481 - 1089 WP_249215684.1 type IV toxin-antitoxin system AbiEi family antitoxin -
P4E65_RS08880 (P4E65_08880) 1931801..1932964 + 1164 WP_039358627.1 M20 aminoacylase family protein -
P4E65_RS08885 (P4E65_08885) 1933081..1933326 + 246 WP_076841742.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
P4E65_RS08890 (P4E65_08890) 1933372..1933611 + 240 WP_232490759.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
P4E65_RS08895 (P4E65_08895) 1933682..1934986 - 1305 WP_039358619.1 cobyrinate a,c-diamide synthase -
P4E65_RS08900 (P4E65_08900) 1934989..1935591 - 603 WP_039358616.1 cob(I)yrinic acid a,c-diamide adenosyltransferase -
P4E65_RS08905 (P4E65_08905) 1935629..1936006 - 378 WP_039358613.1 cobalamin biosynthesis protein -
P4E65_RS08910 (P4E65_08910) 1936003..1936752 - 750 WP_039358610.1 uroporphyrinogen-III C-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(1-74)

Antitoxin

Antitoxin ParD

(1-79)


Sequences

Toxin        


Download         Length: 80 a.a.        Molecular weight: 9325.66 Da        Isoelectric Point: 8.0671

>T275468 WP_232490759.1 NZ_CP120947:1933372-1933611 [Burkholderia contaminans]
IWRDTVGRGSLKQTDLYHRDLIGTMEALARGEKVGRTCIVRDGYFRYAVGSHVVFYRETEYTIDLIRVLHQRMDIEQHL

Download         Length: 240 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 9021.01 Da        Isoelectric Point: 5.6864

>AT275468 WP_076841742.1 NZ_CP120947:1933081-1933326 [Burkholderia contaminans]
MSQNASVSRRDHFAELVDTQVQSEQYGSASDVERTGLRLLESRDMQVRALQEALKAGEVSGALRPFDREAFLARMRAAHD
G

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References