Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapC-vagC/VapC-VagC |
Location | 178250..178887 | Replicon | chromosome |
Accession | NZ_CP120947 | ||
Organism | Burkholderia contaminans strain 5080 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A228K4S8 |
Locus tag | P4E65_RS00735 | Protein ID | WP_039351354.1 |
Coordinates | 178486..178887 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | A0A1E3FXY0 |
Locus tag | P4E65_RS00730 | Protein ID | WP_039351357.1 |
Coordinates | 178250..178486 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P4E65_RS00715 (P4E65_00715) | 173943..174974 | + | 1032 | WP_039351365.1 | helix-turn-helix domain-containing protein | - |
P4E65_RS00720 (P4E65_00720) | 175092..176189 | - | 1098 | WP_039351363.1 | ADP-heptose--LPS heptosyltransferase | - |
P4E65_RS00725 (P4E65_00725) | 176186..177889 | - | 1704 | WP_039351360.1 | thiamine pyrophosphate-binding protein | - |
P4E65_RS00730 (P4E65_00730) | 178250..178486 | + | 237 | WP_039351357.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
P4E65_RS00735 (P4E65_00735) | 178486..178887 | + | 402 | WP_039351354.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
P4E65_RS00740 (P4E65_00740) | 178958..180346 | - | 1389 | WP_039351351.1 | L-serine ammonia-lyase | - |
P4E65_RS00745 (P4E65_00745) | 180377..181480 | - | 1104 | WP_223274380.1 | alginate lyase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14880.98 Da Isoelectric Point: 4.7249
>T275466 WP_039351354.1 NZ_CP120947:178486-178887 [Burkholderia contaminans]
MPRYMLDTNMCIYLMKNQPEQVARRFAQCYTGDVVMSAITYAELEYGVAACASPARERGNLAALIDDIPVAPFDVAAAQA
YGPVREATRERKKDHLDKLIAAHAVSLDVVLVTNNERDFVSYPGLRLENWLDD
MPRYMLDTNMCIYLMKNQPEQVARRFAQCYTGDVVMSAITYAELEYGVAACASPARERGNLAALIDDIPVAPFDVAAAQA
YGPVREATRERKKDHLDKLIAAHAVSLDVVLVTNNERDFVSYPGLRLENWLDD
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A228K4S8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1E3FXY0 |