Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 44159..44718 Replicon plasmid pO157_EDL933_2.1
Accession NZ_CP120945
Organism Escherichia coli O157:H7 str. EDL933

Toxin (Protein)


Gene name relE Uniprot ID O82928
Locus tag P7249_RS27300 Protein ID WP_000421248.1
Coordinates 44159..44434 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C1J8K5
Locus tag P7249_RS27305 Protein ID WP_001178089.1
Coordinates 44434..44718 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P7249_RS27265 (39512) 39512..39901 - 390 WP_001172748.1 cytochrome b562 -
P7249_RS27270 (39945) 39945..42155 - 2211 WP_000592771.1 catalase/peroxidase KatP -
P7249_RS27275 (42332) 42332..42517 + 186 WP_001302179.1 hypothetical protein -
P7249_RS27280 (42517) 42517..42933 + 417 Protein_36 IS91 family transposase -
P7249_RS27285 (42933) 42933..43499 + 567 Protein_37 IS3-like element IS600 family transposase -
P7249_RS27290 (43543) 43543..43758 + 216 Protein_38 transposase -
P7249_RS27295 (43858) 43858..44064 - 207 WP_001105064.1 hypothetical protein -
P7249_RS27300 (44159) 44159..44434 - 276 WP_000421248.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
P7249_RS27305 (44434) 44434..44718 - 285 WP_001178089.1 ribbon-helix-helix domain-containing protein Antitoxin
P7249_RS27310 (45631) 45631..46488 - 858 WP_000130945.1 incFII family plasmid replication initiator RepA -
P7249_RS27315 (46481) 46481..46555 - 75 WP_001370046.1 RepA leader peptide Tap -
P7249_RS27320 (46791) 46791..47045 - 255 WP_000083831.1 replication regulatory protein RepA -
P7249_RS27325 (47285) 47285..47623 - 339 WP_000766796.1 hypothetical protein -
P7249_RS27330 (47661) 47661..47870 - 210 WP_001302200.1 hemolysin expression modulator Hha -
P7249_RS27335 (47916) 47916..48377 - 462 WP_001233853.1 thermonuclease family protein -
P7249_RS27340 (48622) 48622..48834 - 213 WP_001302189.1 ANR family transcriptional regulator -
P7249_RS27345 (48967) 48967..49527 - 561 WP_000840472.1 fertility inhibition protein FinO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - hlyD / hlyB / hlyA / hlyC / exeG / exeE / stcE / espP / toxB 1..92077 92077


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10735.42 Da        Isoelectric Point: 9.9324

>T275465 WP_000421248.1 NZ_CP120945:c44434-44159 [Escherichia coli O157:H7 str. EDL933]
MELKWSSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10474.89 Da        Isoelectric Point: 5.6558

>AT275465 WP_001178089.1 NZ_CP120945:c44718-44434 [Escherichia coli O157:H7 str. EDL933]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z6FAZ0

Antitoxin

Source ID Structure
AlphaFold DB A0A731IHA8

References