Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4858726..4859321 | Replicon | chromosome |
Accession | NZ_CP120944 | ||
Organism | Escherichia coli O157:H7 str. EDL933 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | U9Y4M4 |
Locus tag | P7249_RS24320 | Protein ID | WP_000239579.1 |
Coordinates | 4858726..4859076 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | Q8XCF3 |
Locus tag | P7249_RS24325 | Protein ID | WP_001223210.1 |
Coordinates | 4859070..4859321 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7249_RS24300 (4854172) | 4854172..4855194 | - | 1023 | WP_001301928.1 | ABC transporter permease | - |
P7249_RS24305 (4855208) | 4855208..4856710 | - | 1503 | WP_000205806.1 | sugar ABC transporter ATP-binding protein | - |
P7249_RS24310 (4856850) | 4856850..4857806 | - | 957 | WP_000265942.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
P7249_RS24315 (4858116) | 4858116..4858646 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
P7249_RS24320 (4858726) | 4858726..4859076 | - | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
P7249_RS24325 (4859070) | 4859070..4859321 | - | 252 | WP_001223210.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
P7249_RS24330 (4859533) | 4859533..4859874 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
P7249_RS24335 (4859877) | 4859877..4863656 | - | 3780 | WP_000060930.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T275463 WP_000239579.1 NZ_CP120944:c4859076-4858726 [Escherichia coli O157:H7 str. EDL933]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|