Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4118016..4118634 | Replicon | chromosome |
Accession | NZ_CP120944 | ||
Organism | Escherichia coli O157:H7 str. EDL933 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | P7249_RS20950 | Protein ID | WP_001291435.1 |
Coordinates | 4118416..4118634 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | P7249_RS20945 | Protein ID | WP_000344800.1 |
Coordinates | 4118016..4118390 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7249_RS20935 (4113105) | 4113105..4114298 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
P7249_RS20940 (4114321) | 4114321..4117470 | + | 3150 | WP_001132452.1 | efflux RND transporter permease AcrB | - |
P7249_RS20945 (4118016) | 4118016..4118390 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
P7249_RS20950 (4118416) | 4118416..4118634 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
P7249_RS20955 (4118806) | 4118806..4119357 | + | 552 | WP_000102553.1 | maltose O-acetyltransferase | - |
P7249_RS20960 (4119473) | 4119473..4119943 | + | 471 | WP_000136192.1 | YlaC family protein | - |
P7249_RS20965 (4120107) | 4120107..4121657 | + | 1551 | WP_001301851.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
P7249_RS20970 (4121699) | 4121699..4122052 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
P7249_RS20980 (4122431) | 4122431..4122742 | + | 312 | WP_000409911.1 | MGMT family protein | - |
P7249_RS20985 (4122775) | 4122775..4123347 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T275458 WP_001291435.1 NZ_CP120944:4118416-4118634 [Escherichia coli O157:H7 str. EDL933]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT275458 WP_000344800.1 NZ_CP120944:4118016-4118390 [Escherichia coli O157:H7 str. EDL933]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |