Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 3409524..3410002 Replicon chromosome
Accession NZ_CP120944
Organism Escherichia coli O157:H7 str. EDL933

Toxin (Protein)


Gene name parE_1 Uniprot ID A0A891SFN9
Locus tag P7249_RS17580 Protein ID WP_001303876.1
Coordinates 3409715..3410002 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID Q8XD67
Locus tag P7249_RS17575 Protein ID WP_000536233.1
Coordinates 3409524..3409715 (+) Length 64 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P7249_RS17540 (3404928) 3404928..3405698 - 771 WP_000450992.1 DUF1627 domain-containing protein -
P7249_RS17545 (3405720) 3405720..3406466 - 747 WP_000788751.1 ATP-binding protein -
P7249_RS17550 (3406473) 3406473..3407564 - 1092 WP_001205823.1 hypothetical protein -
P7249_RS17555 (3407643) 3407643..3408098 + 456 WP_000273724.1 hypothetical protein -
P7249_RS17560 (3408305) 3408305..3408730 - 426 WP_000693855.1 toxin YdaT family protein -
P7249_RS17565 (3408714) 3408714..3408986 - 273 WP_000887453.1 YdaS family helix-turn-helix protein -
P7249_RS17570 (3409095) 3409095..3409496 + 402 WP_000986592.1 helix-turn-helix domain-containing protein -
P7249_RS17575 (3409524) 3409524..3409715 + 192 WP_000536233.1 hypothetical protein Antitoxin
P7249_RS17580 (3409715) 3409715..3410002 + 288 WP_001303876.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
P7249_RS17585 (3410280) 3410280..3410435 + 156 WP_000379575.1 DUF1391 family protein -
P7249_RS17590 (3410437) 3410437..3410565 + 129 WP_000344963.1 protein YdfB -
P7249_RS17595 (3410577) 3410577..3410966 + 390 WP_000394511.1 hypothetical protein -
P7249_RS17600 (3411153) 3411153..3411338 - 186 WP_001133046.1 hypothetical protein -
P7249_RS17605 (3411912) 3411912..3412100 + 189 WP_000413705.1 cell division inhibition protein DicB -
P7249_RS17610 (3412097) 3412097..3412288 + 192 WP_001098307.1 DUF1482 family protein -
P7249_RS17615 (3412382) 3412382..3414853 + 2472 WP_000034474.1 exonuclease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10978.84 Da        Isoelectric Point: 10.1360

>T275456 WP_001303876.1 NZ_CP120944:3409715-3410002 [Escherichia coli O157:H7 str. EDL933]
MLPILWLPSARDDLRQIITYIAKENPPAARRLKIRIETSVLPLSEHPYLYPPSERVSGLREIVTHPNYIILYRVAASSIE
IVSVTHSRRQFPFSI

Download         Length: 288 bp

Antitoxin


Download         Length: 64 a.a.        Molecular weight: 7025.80 Da        Isoelectric Point: 4.0270

>AT275456 WP_000536233.1 NZ_CP120944:3409524-3409715 [Escherichia coli O157:H7 str. EDL933]
MGTALSPIVSEFETTEQENSYNEWLRTKVTSSLADTRPAIPHDEVMAEMENLIAQIAVTNKSE

Download         Length: 192 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References