Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2676886..2677524 | Replicon | chromosome |
Accession | NZ_CP120944 | ||
Organism | Escherichia coli O157:H7 str. EDL933 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | P7249_RS13500 | Protein ID | WP_000813794.1 |
Coordinates | 2676886..2677062 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | P7249_RS13505 | Protein ID | WP_001270286.1 |
Coordinates | 2677108..2677524 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7249_RS13480 (2672508) | 2672508..2673680 | - | 1173 | WP_001236316.1 | BenE family transporter YdcO | - |
P7249_RS13485 (2673772) | 2673772..2674308 | + | 537 | WP_000429145.1 | DNA-binding transcriptional regulator SutR | - |
P7249_RS13490 (2674381) | 2674381..2676342 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
P7249_RS13495 (2676434) | 2676434..2676664 | - | 231 | WP_000494244.1 | YncJ family protein | - |
P7249_RS13500 (2676886) | 2676886..2677062 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
P7249_RS13505 (2677108) | 2677108..2677524 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
P7249_RS13510 (2677603) | 2677603..2679009 | + | 1407 | WP_000760654.1 | PLP-dependent aminotransferase family protein | - |
P7249_RS13515 (2679254) | 2679254..2680399 | + | 1146 | WP_000047432.1 | ABC transporter substrate-binding protein | - |
P7249_RS13520 (2680417) | 2680417..2681430 | + | 1014 | WP_000220402.1 | ABC transporter ATP-binding protein | - |
P7249_RS13525 (2681431) | 2681431..2682372 | + | 942 | WP_001251320.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T275455 WP_000813794.1 NZ_CP120944:2676886-2677062 [Escherichia coli O157:H7 str. EDL933]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT275455 WP_001270286.1 NZ_CP120944:2677108-2677524 [Escherichia coli O157:H7 str. EDL933]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|