Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1036225..1036808 | Replicon | chromosome |
Accession | NZ_CP120944 | ||
Organism | Escherichia coli O157:H7 str. EDL933 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | P7249_RS05125 | Protein ID | WP_000254738.1 |
Coordinates | 1036473..1036808 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | P7249_RS05120 | Protein ID | WP_000581937.1 |
Coordinates | 1036225..1036473 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7249_RS05110 (1032564) | 1032564..1033865 | + | 1302 | WP_000046824.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
P7249_RS05115 (1033913) | 1033913..1036147 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
P7249_RS05120 (1036225) | 1036225..1036473 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
P7249_RS05125 (1036473) | 1036473..1036808 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
P7249_RS05130 (1036879) | 1036879..1037670 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
P7249_RS05135 (1037898) | 1037898..1039535 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
P7249_RS05140 (1039623) | 1039623..1040921 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T275446 WP_000254738.1 NZ_CP120944:1036473-1036808 [Escherichia coli O157:H7 str. EDL933]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|