Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 890744..891398 | Replicon | chromosome |
Accession | NZ_CP120944 | ||
Organism | Escherichia coli O157:H7 str. EDL933 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | P7249_RS04460 | Protein ID | WP_000244781.1 |
Coordinates | 890991..891398 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | P7249_RS04455 | Protein ID | WP_000354046.1 |
Coordinates | 890744..891010 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7249_RS04435 (886832) | 886832..888265 | - | 1434 | WP_001310226.1 | 6-phospho-beta-glucosidase BglA | - |
P7249_RS04440 (888310) | 888310..888621 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
P7249_RS04445 (888785) | 888785..889444 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
P7249_RS04450 (889521) | 889521..890501 | - | 981 | WP_000886053.1 | tRNA-modifying protein YgfZ | - |
P7249_RS04455 (890744) | 890744..891010 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
P7249_RS04460 (890991) | 890991..891398 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
P7249_RS04465 (891438) | 891438..891959 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
P7249_RS04470 (892071) | 892071..892967 | + | 897 | WP_000806640.1 | site-specific tyrosine recombinase XerD | - |
P7249_RS04475 (892992) | 892992..893702 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
P7249_RS04480 (893708) | 893708..895441 | + | 1734 | WP_000813185.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T275445 WP_000244781.1 NZ_CP120944:890991-891398 [Escherichia coli O157:H7 str. EDL933]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|