Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 401241..401995 | Replicon | chromosome |
Accession | NZ_CP120944 | ||
Organism | Escherichia coli O157:H7 str. EDL933 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | P7249_RS01920 | Protein ID | WP_001301452.1 |
Coordinates | 401241..401726 (-) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | Q8X700 |
Locus tag | P7249_RS01925 | Protein ID | WP_000801912.1 |
Coordinates | 401717..401995 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7249_RS01900 (396407) | 396407..397165 | + | 759 | WP_001302007.1 | DeoR/GlpR family transcriptional regulator | - |
P7249_RS01905 (397147) | 397147..398745 | - | 1599 | WP_001232889.1 | DNA-binding transcriptional regulator RtcR | - |
P7249_RS01910 (398933) | 398933..400159 | + | 1227 | WP_001105473.1 | RNA-splicing ligase RtcB | - |
P7249_RS01915 (400163) | 400163..401191 | + | 1029 | WP_000827117.1 | RNA 3'-terminal phosphate cyclase | - |
P7249_RS01920 (401241) | 401241..401726 | - | 486 | WP_001301452.1 | GNAT family N-acetyltransferase | Toxin |
P7249_RS01925 (401717) | 401717..401995 | - | 279 | WP_000801912.1 | DUF1778 domain-containing protein | Antitoxin |
P7249_RS01930 (402062) | 402062..404767 | - | 2706 | WP_000906970.1 | HTH-type transcriptional regulator MalT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17650.57 Da Isoelectric Point: 9.4066
>T275442 WP_001301452.1 NZ_CP120944:c401726-401241 [Escherichia coli O157:H7 str. EDL933]
MGITAPTPLTSEHNLADFCCSDHGMNEWLKKKALKNHSSGLSRVYVICIANTRQVIGYYCLSTGSIQRNLAPGAMRRNAP
ESLPVVVLGRLAIDQAWAGKGLGVALLKDAVYRTMSIAQQVGVRALIVHALDDSVRNFYLKYAFVPSPFQSLTLLYPITL
E
MGITAPTPLTSEHNLADFCCSDHGMNEWLKKKALKNHSSGLSRVYVICIANTRQVIGYYCLSTGSIQRNLAPGAMRRNAP
ESLPVVVLGRLAIDQAWAGKGLGVALLKDAVYRTMSIAQQVGVRALIVHALDDSVRNFYLKYAFVPSPFQSLTLLYPITL
E
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|