Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 352311..353111 | Replicon | chromosome |
| Accession | NZ_CP120944 | ||
| Organism | Escherichia coli O157:H7 str. EDL933 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | Q8XED1 |
| Locus tag | P7249_RS01710 | Protein ID | WP_000342450.1 |
| Coordinates | 352584..353111 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | F4NNI1 |
| Locus tag | P7249_RS01705 | Protein ID | WP_001277108.1 |
| Coordinates | 352311..352577 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P7249_RS01685 (347969) | 347969..348637 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
| P7249_RS01690 (348630) | 348630..349688 | + | 1059 | WP_001042018.1 | permease-like cell division protein FtsX | - |
| P7249_RS01695 (349933) | 349933..350787 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| P7249_RS01700 (351058) | 351058..352161 | + | 1104 | WP_001021996.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| P7249_RS01705 (352311) | 352311..352577 | + | 267 | WP_001277108.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| P7249_RS01710 (352584) | 352584..353111 | + | 528 | WP_000342450.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| P7249_RS01715 (353108) | 353108..353491 | - | 384 | WP_000778769.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| P7249_RS01720 (353915) | 353915..355024 | + | 1110 | WP_001301528.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| P7249_RS01725 (355072) | 355072..355998 | + | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| P7249_RS01730 (355995) | 355995..357272 | + | 1278 | WP_000803797.1 | branched chain amino acid ABC transporter permease LivM | - |
| P7249_RS01735 (357269) | 357269..358036 | + | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19678.61 Da Isoelectric Point: 6.9489
>T275441 WP_000342450.1 NZ_CP120944:352584-353111 [Escherichia coli O157:H7 str. EDL933]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMNVVWSASLAVGIHGLFVEALNEKAHTFYKSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMNVVWSASLAVGIHGLFVEALNEKAHTFYKSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|