Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yoeB-relB/YoeB-YefM
Location 2170799..2171301 Replicon chromosome
Accession NZ_CP120942
Organism Aeromonas caviae strain AC1520

Toxin (Protein)


Gene name yoeB Uniprot ID Q5XQD8
Locus tag P5S46_RS10060 Protein ID WP_032492620.1
Coordinates 2170799..2171053 (-) Length 85 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A1V0BEH6
Locus tag P5S46_RS10065 Protein ID WP_032492621.1
Coordinates 2171050..2171301 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5S46_RS10040 (P5S46_10040) 2167178..2167738 - 561 WP_001161490.1 recombinase family protein -
P5S46_RS10045 (P5S46_10045) 2168075..2169088 - 1014 WP_000845048.1 class 1 integron integrase IntI1 -
P5S46_RS10050 (P5S46_10050) 2169335..2170123 + 789 Protein_1938 AadA family aminoglycoside 3''-O-nucleotidyltransferase -
P5S46_RS10055 (P5S46_10055) 2170172..2170726 + 555 WP_012695458.1 AAC(6')-Ib family aminoglycoside 6'-N-acetyltransferase -
P5S46_RS10060 (P5S46_10060) 2170799..2171053 - 255 WP_032492620.1 Txe/YoeB family addiction module toxin Toxin
P5S46_RS10065 (P5S46_10065) 2171050..2171301 - 252 WP_032492621.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
P5S46_RS10070 (P5S46_10070) 2171485..2172117 + 633 WP_000186237.1 type B-3 chloramphenicol O-acetyltransferase CatB3 -
P5S46_RS10075 (P5S46_10075) 2172274..2172621 + 348 WP_000679427.1 quaternary ammonium compound efflux SMR transporter QacE delta 1 -
P5S46_RS10080 (P5S46_10080) 2172615..2173454 + 840 WP_000259031.1 sulfonamide-resistant dihydropteroate synthase Sul1 -
P5S46_RS10085 (P5S46_10085) 2173859..2175400 + 1542 WP_000050481.1 IS91-like element ISCR1 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island ant(3'')-Ii-aac(6')-IId / catB3 / sul1 / blaPER-3 / mph(A) - 2163253..2198932 35679
- inside IScluster/Tn ant(3'')-Ii-aac(6')-IId / catB3 / sul1 / blaPER-3 / mph(A) - 2164208..2193876 29668
- inside Integron catB3 - 2168075..2172171 4096


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 10272.81 Da        Isoelectric Point: 9.3585

>T275438 WP_032492620.1 NZ_CP120942:c2171053-2170799 [Aeromonas caviae]
MRLIFSDDAWEDYLFWQKQDRRMVDRINKLIKETTREPFSGVGKPEPLKHALAGYWSRRITDEHRMVYKVADDALWIVQL
KYHY

Download         Length: 255 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9244.40 Da        Isoelectric Point: 4.7769

>AT275438 WP_032492621.1 NZ_CP120942:c2171301-2171050 [Aeromonas caviae]
MDAITYTHARANLAGTMDRVCNDHEPVIITRNGDQSVVILSLEDFQALEETAYLLRSPANAKRLFKSIEQLEAGRGQARE
LAE

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1V0BEH9

Antitoxin

Source ID Structure
AlphaFold DB A0A1V0BEH6

References