Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 570988..571624 | Replicon | chromosome |
Accession | NZ_CP120920 | ||
Organism | Bacillus paralicheniformis strain SYN-191 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | M5P3Q9 |
Locus tag | P3X35_RS02855 | Protein ID | WP_003179128.1 |
Coordinates | 571274..571624 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | M5PDU2 |
Locus tag | P3X35_RS02850 | Protein ID | WP_006638778.1 |
Coordinates | 570988..571269 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P3X35_RS02830 (P3X35_02830) | 566099..567583 | + | 1485 | WP_277868558.1 | PH domain-containing protein | - |
P3X35_RS02835 (P3X35_02835) | 567580..568179 | - | 600 | WP_277868559.1 | rhomboid family intramembrane serine protease | - |
P3X35_RS02840 (P3X35_02840) | 568523..569482 | + | 960 | WP_165973180.1 | outer membrane lipoprotein carrier protein LolA | - |
P3X35_RS02845 (P3X35_02845) | 569707..570876 | + | 1170 | WP_205689354.1 | alanine racemase | - |
P3X35_RS02850 (P3X35_02850) | 570988..571269 | + | 282 | WP_006638778.1 | hypothetical protein | Antitoxin |
P3X35_RS02855 (P3X35_02855) | 571274..571624 | + | 351 | WP_003179128.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
P3X35_RS02860 (P3X35_02860) | 571742..572569 | + | 828 | WP_023857863.1 | RsbT co-antagonist protein RsbRA | - |
P3X35_RS02865 (P3X35_02865) | 572573..572938 | + | 366 | WP_031305225.1 | STAS domain-containing protein | - |
P3X35_RS02870 (P3X35_02870) | 572941..573342 | + | 402 | WP_023857861.1 | anti-sigma regulatory factor | - |
P3X35_RS02875 (P3X35_02875) | 573353..574360 | + | 1008 | WP_020450261.1 | PP2C family protein-serine/threonine phosphatase | - |
P3X35_RS02880 (P3X35_02880) | 574419..574745 | + | 327 | WP_020450262.1 | anti-sigma factor antagonist | - |
P3X35_RS02885 (P3X35_02885) | 574745..575227 | + | 483 | WP_020450263.1 | anti-sigma B factor RsbW | - |
P3X35_RS02890 (P3X35_02890) | 575193..575984 | + | 792 | WP_023857858.1 | RNA polymerase sigma factor SigB | - |
P3X35_RS02895 (P3X35_02895) | 575981..576580 | + | 600 | WP_035337155.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12990.03 Da Isoelectric Point: 5.7234
>T275435 WP_003179128.1 NZ_CP120920:571274-571624 [Bacillus paralicheniformis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6I7FHI4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | M5PDU2 |