Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 87387..87912 Replicon plasmid pKPHRJ
Accession NZ_CP120848
Organism Klebsiella pneumoniae strain KPHRJ

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag P5D18_RS26970 Protein ID WP_013023785.1
Coordinates 87387..87692 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag P5D18_RS26975 Protein ID WP_001568025.1
Coordinates 87694..87912 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5D18_RS26940 (P5D18_26940) 83082..83708 + 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -
P5D18_RS26945 (P5D18_26945) 83705..84007 + 303 WP_004197636.1 hypothetical protein -
P5D18_RS26950 (P5D18_26950) 84463..85257 - 795 WP_004197635.1 site-specific integrase -
P5D18_RS26955 (P5D18_26955) 85455..86471 - 1017 WP_017899884.1 hypothetical protein -
P5D18_RS26960 (P5D18_26960) 86482..86796 - 315 WP_053389906.1 hypothetical protein -
P5D18_RS26965 (P5D18_26965) 86823..87218 - 396 WP_017899885.1 hypothetical protein -
P5D18_RS26970 (P5D18_26970) 87387..87692 - 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
P5D18_RS26975 (P5D18_26975) 87694..87912 - 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
P5D18_RS26980 (P5D18_26980) 88082..88543 - 462 WP_160880186.1 hypothetical protein -
P5D18_RS26985 (P5D18_26985) 88500..88730 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin -
P5D18_RS26990 (P5D18_26990) 88727..89143 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin -
P5D18_RS26995 (P5D18_26995) 89217..90779 + 1563 WP_004206609.1 AAA family ATPase -
P5D18_RS27000 (P5D18_27000) 90764..91786 + 1023 WP_000361404.1 helicase UvrD -
P5D18_RS27005 (P5D18_27005) 92042..92739 + 698 WP_223174630.1 IS1 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaKPC-33 / tet(A) - 1..133718 133718


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T275431 WP_013023785.1 NZ_CP120848:c87692-87387 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT275431 WP_001568025.1 NZ_CP120848:c87912-87694 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References