Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 60800..61443 Replicon plasmid pKPHRJ
Accession NZ_CP120848
Organism Klebsiella pneumoniae strain KPHRJ

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag P5D18_RS26795 Protein ID WP_014386165.1
Coordinates 61027..61443 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag P5D18_RS26790 Protein ID WP_032408893.1
Coordinates 60800..61030 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5D18_RS26765 (P5D18_26765) 55873..56856 - 984 WP_001471744.1 NAD(P)H-quinone oxidoreductase -
P5D18_RS26770 (P5D18_26770) 56875..58023 - 1149 WP_014386168.1 ABC transporter ATP-binding protein -
P5D18_RS26775 (P5D18_26775) 58194..59351 - 1158 WP_032408895.1 acetylornithine deacetylase -
P5D18_RS26780 (P5D18_26780) 59367..60041 - 675 WP_014386166.1 DUF1028 domain-containing protein -
P5D18_RS26785 (P5D18_26785) 60046..60480 - 435 WP_000103648.1 RidA family protein -
P5D18_RS26790 (P5D18_26790) 60800..61030 + 231 WP_032408893.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
P5D18_RS26795 (P5D18_26795) 61027..61443 + 417 WP_014386165.1 PIN domain-containing protein Toxin
P5D18_RS26800 (P5D18_26800) 61766..62734 + 969 WP_074422984.1 IS5-like element IS903B family transposase -
P5D18_RS26805 (P5D18_26805) 62914..63288 - 375 WP_032408891.1 hypothetical protein -
P5D18_RS26810 (P5D18_26810) 63344..63670 - 327 WP_004152639.1 hypothetical protein -
P5D18_RS26815 (P5D18_26815) 63667..64395 - 729 WP_014386162.1 plasmid SOS inhibition protein A -
P5D18_RS26820 (P5D18_26820) 64392..64823 - 432 WP_014386161.1 conjugation system SOS inhibitor PsiB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaKPC-33 / tet(A) - 1..133718 133718
- flank IS/Tn - - 61766..62734 968


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-130)

Antitoxin

SpoVT-AbrB domain

(7-55)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15127.44 Da        Isoelectric Point: 7.8841

>T275430 WP_014386165.1 NZ_CP120848:61027-61443 [Klebsiella pneumoniae]
MTKTYMLDTNICSYIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGAIGKRASPRHVQLVDAFCARLDAILAWDRA
AVDATTEVKATLAAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVAGLTFEDWVQ

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8854.89 Da        Isoelectric Point: 4.5112

>AT275430 WP_032408893.1 NZ_CP120848:60800-61030 [Klebsiella pneumoniae]
MRTVSVFRNGNNRAIRLPRDLDFDGVNELEIIREGDTLILRPVKPSWSSFRQEEKADADFMAERENVVSDEGRFEL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References