Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 36904..37649 | Replicon | plasmid pKPHRJ |
| Accession | NZ_CP120848 | ||
| Organism | Klebsiella pneumoniae strain KPHRJ | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A331KSM6 |
| Locus tag | P5D18_RS26665 | Protein ID | WP_032408901.1 |
| Coordinates | 37158..37649 (+) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | - |
| Locus tag | P5D18_RS26660 | Protein ID | WP_014386183.1 |
| Coordinates | 36904..37170 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5D18_RS26610 (P5D18_26610) | 32456..32869 | - | 414 | WP_013023817.1 | helix-turn-helix domain-containing protein | - |
| P5D18_RS26615 (P5D18_26615) | 32870..33148 | - | 279 | WP_004152721.1 | helix-turn-helix transcriptional regulator | - |
| P5D18_RS26620 (P5D18_26620) | 33138..33458 | - | 321 | WP_014386190.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| P5D18_RS26625 (P5D18_26625) | 33539..33763 | - | 225 | WP_014386189.1 | hypothetical protein | - |
| P5D18_RS26630 (P5D18_26630) | 33774..33986 | - | 213 | WP_014386188.1 | hypothetical protein | - |
| P5D18_RS26635 (P5D18_26635) | 34048..34374 | - | 327 | WP_014386187.1 | hypothetical protein | - |
| P5D18_RS26640 (P5D18_26640) | 35011..35361 | - | 351 | WP_014386186.1 | hypothetical protein | - |
| P5D18_RS26645 (P5D18_26645) | 35358..35630 | - | 273 | WP_032408902.1 | hypothetical protein | - |
| P5D18_RS26650 (P5D18_26650) | 35820..36305 | + | 486 | WP_014386185.1 | hypothetical protein | - |
| P5D18_RS26655 (P5D18_26655) | 36549..36707 | - | 159 | WP_014386184.1 | type I toxin-antitoxin system Hok family toxin | - |
| P5D18_RS26660 (P5D18_26660) | 36904..37170 | + | 267 | WP_014386183.1 | DUF1778 domain-containing protein | Antitoxin |
| P5D18_RS26665 (P5D18_26665) | 37158..37649 | + | 492 | WP_032408901.1 | GNAT family N-acetyltransferase | Toxin |
| P5D18_RS26670 (P5D18_26670) | 38090..38341 | - | 252 | WP_032408900.1 | aldo/keto reductase | - |
| P5D18_RS26675 (P5D18_26675) | 38538..40130 | - | 1593 | Protein_53 | IS66 family transposase | - |
| P5D18_RS26680 (P5D18_26680) | 40161..40511 | - | 351 | WP_014386180.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| P5D18_RS26685 (P5D18_26685) | 40508..40948 | - | 441 | WP_014386179.1 | transposase | - |
| P5D18_RS26690 (P5D18_26690) | 41210..41965 | - | 756 | WP_032408898.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaKPC-33 / tet(A) | - | 1..133718 | 133718 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17667.46 Da Isoelectric Point: 8.8757
>T275429 WP_032408901.1 NZ_CP120848:37158-37649 [Klebsiella pneumoniae]
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|