Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4128147..4128766 Replicon chromosome
Accession NZ_CP120847
Organism Klebsiella pneumoniae strain KPHRJ

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag P5D18_RS20145 Protein ID WP_002892050.1
Coordinates 4128548..4128766 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag P5D18_RS20140 Protein ID WP_002892066.1
Coordinates 4128147..4128521 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5D18_RS20130 (4123299) 4123299..4124492 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
P5D18_RS20135 (4124515) 4124515..4127661 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
P5D18_RS20140 (4128147) 4128147..4128521 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
P5D18_RS20145 (4128548) 4128548..4128766 + 219 WP_002892050.1 HHA domain-containing protein Toxin
P5D18_RS20150 (4128925) 4128925..4129491 + 567 WP_002892030.1 maltose O-acetyltransferase -
P5D18_RS20155 (4129463) 4129463..4129603 - 141 WP_004147370.1 hypothetical protein -
P5D18_RS20160 (4129624) 4129624..4130094 + 471 WP_002892026.1 YlaC family protein -
P5D18_RS20165 (4130069) 4130069..4131520 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
P5D18_RS20170 (4131621) 4131621..4132319 + 699 WP_002892021.1 GNAT family protein -
P5D18_RS20175 (4132316) 4132316..4132456 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
P5D18_RS20180 (4132456) 4132456..4132719 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T275424 WP_002892050.1 NZ_CP120847:4128548-4128766 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT275424 WP_002892066.1 NZ_CP120847:4128147-4128521 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References