Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4128147..4128766 | Replicon | chromosome |
Accession | NZ_CP120847 | ||
Organism | Klebsiella pneumoniae strain KPHRJ |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | P5D18_RS20145 | Protein ID | WP_002892050.1 |
Coordinates | 4128548..4128766 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | P5D18_RS20140 | Protein ID | WP_002892066.1 |
Coordinates | 4128147..4128521 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5D18_RS20130 (4123299) | 4123299..4124492 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
P5D18_RS20135 (4124515) | 4124515..4127661 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
P5D18_RS20140 (4128147) | 4128147..4128521 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
P5D18_RS20145 (4128548) | 4128548..4128766 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
P5D18_RS20150 (4128925) | 4128925..4129491 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
P5D18_RS20155 (4129463) | 4129463..4129603 | - | 141 | WP_004147370.1 | hypothetical protein | - |
P5D18_RS20160 (4129624) | 4129624..4130094 | + | 471 | WP_002892026.1 | YlaC family protein | - |
P5D18_RS20165 (4130069) | 4130069..4131520 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
P5D18_RS20170 (4131621) | 4131621..4132319 | + | 699 | WP_002892021.1 | GNAT family protein | - |
P5D18_RS20175 (4132316) | 4132316..4132456 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
P5D18_RS20180 (4132456) | 4132456..4132719 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T275424 WP_002892050.1 NZ_CP120847:4128548-4128766 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT275424 WP_002892066.1 NZ_CP120847:4128147-4128521 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |