Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 532933..533569 | Replicon | chromosome |
Accession | NZ_CP120846 | ||
Organism | Bacillus atrophaeus strain MBLB1156 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | P4829_RS02655 | Protein ID | WP_003156187.1 |
Coordinates | 533219..533569 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A837XXL9 |
Locus tag | P4829_RS02650 | Protein ID | WP_003328141.1 |
Coordinates | 532933..533214 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P4829_RS02630 (529229) | 529229..529828 | - | 600 | WP_010789631.1 | rhomboid family intramembrane serine protease | - |
P4829_RS02635 (529928) | 529928..530293 | + | 366 | WP_061669621.1 | holo-ACP synthase | - |
P4829_RS02640 (530461) | 530461..531477 | + | 1017 | WP_094231401.1 | outer membrane lipoprotein carrier protein LolA | - |
P4829_RS02645 (531645) | 531645..532814 | + | 1170 | WP_063638785.1 | alanine racemase | - |
P4829_RS02650 (532933) | 532933..533214 | + | 282 | WP_003328141.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
P4829_RS02655 (533219) | 533219..533569 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
P4829_RS02660 (533685) | 533685..534503 | + | 819 | WP_010789627.1 | RsbT co-antagonist protein RsbRA | - |
P4829_RS02665 (534508) | 534508..534873 | + | 366 | WP_010789626.1 | RsbT antagonist protein RsbS | - |
P4829_RS02670 (534876) | 534876..535277 | + | 402 | WP_003328144.1 | serine/threonine-protein kinase RsbT | - |
P4829_RS02675 (535289) | 535289..536296 | + | 1008 | WP_063638786.1 | PP2C family protein-serine/threonine phosphatase | - |
P4829_RS02680 (536356) | 536356..536685 | + | 330 | WP_003328146.1 | anti-sigma factor antagonist RsbV | - |
P4829_RS02685 (536682) | 536682..537164 | + | 483 | WP_003328147.1 | anti-sigma B factor RsbW | - |
P4829_RS02690 (537130) | 537130..537918 | + | 789 | WP_003328149.1 | RNA polymerase sigma factor SigB | - |
P4829_RS02695 (537918) | 537918..538517 | + | 600 | WP_003328150.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T275413 WP_003156187.1 NZ_CP120846:533219-533569 [Bacillus atrophaeus]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 4MDX | |
PDB | 4ME7 | |
PDB | 1NE8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837XXL9 |