Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 10542..11067 Replicon plasmid unnamed1
Accession NZ_CP120838
Organism Salmonella enterica subsp. enterica strain 21A

Toxin (Protein)


Gene name ccdB Uniprot ID I3W3D5
Locus tag P4B21_RS22815 Protein ID WP_001159863.1
Coordinates 10762..11067 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7S5D0
Locus tag P4B21_RS22810 Protein ID WP_000813641.1
Coordinates 10542..10760 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P4B21_RS22780 (P4B21_22780) 6156..6542 + 387 WP_000751876.1 YgiW/YdeI family stress tolerance OB fold protein -
P4B21_RS22785 (P4B21_22785) 6595..6714 + 120 Protein_8 recombinase -
P4B21_RS22790 (P4B21_22790) 7083..8072 - 990 WP_000461382.1 RepB family plasmid replication initiator protein -
P4B21_RS22795 (P4B21_22795) 8566..8861 - 296 Protein_10 cytoplasmic protein -
P4B21_RS22800 (P4B21_22800) 8873..9301 + 429 Protein_11 hypothetical protein -
P4B21_RS22805 (P4B21_22805) 9345..9866 - 522 WP_077681952.1 hypothetical protein -
P4B21_RS22810 (P4B21_22810) 10542..10760 + 219 WP_000813641.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
P4B21_RS22815 (P4B21_22815) 10762..11067 + 306 WP_001159863.1 type II toxin-antitoxin system toxin CcdB Toxin
P4B21_RS22820 (P4B21_22820) 11069..11359 + 291 WP_001266176.1 hypothetical protein -
P4B21_RS22825 (P4B21_22825) 11356..11877 + 522 WP_000198608.1 hypothetical protein -
P4B21_RS22830 (P4B21_22830) 11912..12694 + 783 WP_000082169.1 site-specific integrase -
P4B21_RS22835 (P4B21_22835) 12703..13416 + 714 WP_000545756.1 EAL domain-containing protein -
P4B21_RS22840 (P4B21_22840) 13441..13929 + 489 WP_001075507.1 CaiF/GrlA family transcriptional regulator -
P4B21_RS22845 (P4B21_22845) 13923..14408 + 486 WP_000905606.1 membrane protein -
P4B21_RS22850 (P4B21_22850) 14685..14972 - 288 WP_071530243.1 hypothetical protein -
P4B21_RS22855 (P4B21_22855) 15128..15688 + 561 WP_000900095.1 inverse autotransporter beta domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaTEM-1B pefD / pefC / pefA / pefB / fdeC / spvC / spvB / rck 1..64327 64327


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11587.48 Da        Isoelectric Point: 6.9787

>T275412 WP_001159863.1 NZ_CP120838:10762-11067 [Salmonella enterica subsp. enterica]
MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSEKVPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEV
ADLSLRENDIKNAINLMFRGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8314.16 Da        Isoelectric Point: 4.5203

>AT275412 WP_000813641.1 NZ_CP120838:10542-10760 [Salmonella enterica subsp. enterica]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQEENREGMAEVASFIEANGSFADDNRNW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB I3W3D5

Antitoxin

Source ID Structure
AlphaFold DB A0A656ICA6

References