Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 4179228..4180009 | Replicon | chromosome |
| Accession | NZ_CP120837 | ||
| Organism | Salmonella enterica subsp. enterica strain 21A | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | B5R980 |
| Locus tag | P4B21_RS20455 | Protein ID | WP_000626100.1 |
| Coordinates | 4179228..4179719 (-) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | B5R979 |
| Locus tag | P4B21_RS20460 | Protein ID | WP_001110452.1 |
| Coordinates | 4179716..4180009 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P4B21_RS20420 (4174688) | 4174688..4175035 | + | 348 | WP_000887832.1 | divalent cation tolerance protein CutA | - |
| P4B21_RS20425 (4175011) | 4175011..4176714 | + | 1704 | WP_000068885.1 | protein-disulfide reductase DsbD | - |
| P4B21_RS20430 (4176751) | 4176751..4177326 | + | 576 | WP_001188509.1 | transcriptional regulator | - |
| P4B21_RS20440 (4177597) | 4177597..4177671 | - | 75 | Protein_3994 | helix-turn-helix domain-containing protein | - |
| P4B21_RS20445 (4178051) | 4178051..4178128 | + | 78 | Protein_3995 | porin family protein | - |
| P4B21_RS20450 (4178228) | 4178228..4178980 | + | 753 | WP_000842433.1 | non-specific acid phosphatase | - |
| P4B21_RS20455 (4179228) | 4179228..4179719 | - | 492 | WP_000626100.1 | GNAT family N-acetyltransferase | Toxin |
| P4B21_RS20460 (4179716) | 4179716..4180009 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
| P4B21_RS20465 (4180326) | 4180326..4180547 | + | 222 | WP_001576552.1 | hypothetical protein | - |
| P4B21_RS20470 (4180813) | 4180813..4181688 | + | 876 | WP_000921676.1 | AraC family transcriptional regulator | - |
| P4B21_RS20475 (4181685) | 4181685..4181972 | + | 288 | WP_001541332.1 | transcriptional regulator RtsB | - |
| P4B21_RS20480 (4181965) | 4181965..4182273 | - | 309 | WP_072095651.1 | ABC transporter ATP-binding protein | - |
| P4B21_RS20485 (4182272) | 4182272..4182520 | + | 249 | Protein_4003 | Ig-like domain-containing protein | - |
| P4B21_RS20490 (4182632) | 4182632..4182763 | + | 132 | Protein_4004 | hypothetical protein | - |
| P4B21_RS20495 (4183057) | 4183057..4183962 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17645.45 Da Isoelectric Point: 7.7297
>T275409 WP_000626100.1 NZ_CP120837:c4179719-4179228 [Salmonella enterica subsp. enterica]
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A656IQ80 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7AK7 | |
| AlphaFold DB | A0A5I1DGA4 |