Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 4031207..4031757 | Replicon | chromosome |
| Accession | NZ_CP120837 | ||
| Organism | Salmonella enterica subsp. enterica strain 21A | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | M7RJ32 |
| Locus tag | P4B21_RS19675 | Protein ID | WP_001199743.1 |
| Coordinates | 4031207..4031515 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | M7RP97 |
| Locus tag | P4B21_RS19680 | Protein ID | WP_001118105.1 |
| Coordinates | 4031518..4031757 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P4B21_RS19655 (4027781) | 4027781..4028521 | - | 741 | WP_001676217.1 | SEF14/SEF18 fimbria chaperone SefB | - |
| P4B21_RS19660 (4028643) | 4028643..4029173 | - | 531 | WP_000909461.1 | SEF14 fimbria major subunit SefA | - |
| P4B21_RS19665 (4029496) | 4029496..4030629 | + | 1134 | Protein_3844 | IS3 family transposase | - |
| P4B21_RS19670 (4030661) | 4030661..4030801 | - | 141 | Protein_3845 | Arm DNA-binding domain-containing protein | - |
| P4B21_RS19675 (4031207) | 4031207..4031515 | - | 309 | WP_001199743.1 | CcdB family protein | Toxin |
| P4B21_RS19680 (4031518) | 4031518..4031757 | - | 240 | WP_001118105.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| P4B21_RS19685 (4031866) | 4031866..4032114 | - | 249 | WP_000168388.1 | ribbon-helix-helix domain-containing protein | - |
| P4B21_RS19690 (4032191) | 4032191..4032736 | - | 546 | WP_223151225.1 | helix-turn-helix domain-containing protein | - |
| P4B21_RS19700 (4033493) | 4033493..4034512 | + | 1020 | WP_000152558.1 | NAD(P)-dependent alcohol dehydrogenase | - |
| P4B21_RS19705 (4034540) | 4034540..4035070 | - | 531 | WP_000896758.1 | gluconokinase | - |
| P4B21_RS19710 (4035287) | 4035287..4036318 | + | 1032 | WP_000453347.1 | L-idonate 5-dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 4029588..4032691 | 3103 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T275407 WP_001199743.1 NZ_CP120837:c4031515-4031207 [Salmonella enterica subsp. enterica]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H9SZK8 |