Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 3986947..3987523 | Replicon | chromosome |
| Accession | NZ_CP120837 | ||
| Organism | Salmonella enterica subsp. enterica strain 21A | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | M7RG88 |
| Locus tag | P4B21_RS19460 | Protein ID | WP_001131963.1 |
| Coordinates | 3987236..3987523 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | B5R9R5 |
| Locus tag | P4B21_RS19455 | Protein ID | WP_000063142.1 |
| Coordinates | 3986947..3987249 (-) | Length | 101 a.a. |
Genomic Context
Location: 3983457..3985607 (2151 bp)
Type: Others
Protein ID: WP_000379928.1
Type: Others
Protein ID: WP_000379928.1
Location: 3985702..3985905 (204 bp)
Type: Others
Protein ID: WP_000460616.1
Type: Others
Protein ID: WP_000460616.1
Location: 3985916..3986872 (957 bp)
Type: Others
Protein ID: WP_000187843.1
Type: Others
Protein ID: WP_000187843.1
Location: 3987940..3989196 (1257 bp)
Type: Others
Protein ID: Protein_3804
Type: Others
Protein ID: Protein_3804
Location: 3989190..3989369 (180 bp)
Type: Others
Protein ID: Protein_3805
Type: Others
Protein ID: Protein_3805
Location: 3989359..3990663 (1305 bp)
Type: Others
Protein ID: WP_000863534.1
Type: Others
Protein ID: WP_000863534.1
Location: 3986947..3987249 (303 bp)
Type: Antitoxin
Protein ID: WP_000063142.1
Type: Antitoxin
Protein ID: WP_000063142.1
Location: 3987236..3987523 (288 bp)
Type: Toxin
Protein ID: WP_001131963.1
Type: Toxin
Protein ID: WP_001131963.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P4B21_RS19440 (3983457) | 3983457..3985607 | + | 2151 | WP_000379928.1 | pyruvate/proton symporter BtsT | - |
| P4B21_RS19445 (3985702) | 3985702..3985905 | + | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
| P4B21_RS19450 (3985916) | 3985916..3986872 | + | 957 | WP_000187843.1 | GTPase | - |
| P4B21_RS19455 (3986947) | 3986947..3987249 | - | 303 | WP_000063142.1 | BrnA antitoxin family protein | Antitoxin |
| P4B21_RS19460 (3987236) | 3987236..3987523 | - | 288 | WP_001131963.1 | BrnT family toxin | Toxin |
| P4B21_RS19465 (3987940) | 3987940..3989196 | + | 1257 | Protein_3804 | NERD domain-containing protein/DEAD/DEAH box helicase | - |
| P4B21_RS19470 (3989190) | 3989190..3989369 | + | 180 | Protein_3805 | DNA methyltransferase | - |
| P4B21_RS19475 (3989359) | 3989359..3990663 | + | 1305 | WP_000863534.1 | type I restriction-modification protein specificity subunit | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11294.80 Da Isoelectric Point: 9.5894
>T275406 WP_001131963.1 NZ_CP120837:c3987523-3987236 [Salmonella enterica subsp. enterica]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11373.96 Da Isoelectric Point: 10.1293
>AT275406 WP_000063142.1 NZ_CP120837:c3987249-3986947 [Salmonella enterica subsp. enterica]
MSMVKHKRGNASALSAQHEAELKALAKKSDDEIDYSDIPASEDGQWSEAVRGKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
MSMVKHKRGNASALSAQHEAELKALAKKSDDEIDYSDIPASEDGQWSEAVRGKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
Download Length: 303 bp
Structures
Toxin
Loading, please wait
Source | ID | Structure |
|---|---|---|
| PDB | 7VD7 |
Antitoxin
Loading, please wait
Source | ID | Structure |
|---|---|---|
| PDB | 7VD7 | |
| AlphaFold DB | A0A4D6PB01 |