Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 191594..192233 | Replicon | chromosome |
Accession | NZ_CP120733 | ||
Organism | Tepidibacter sp. SWIR-1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | P4S50_RS00755 | Protein ID | WP_277732602.1 |
Coordinates | 191871..192233 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | P4S50_RS00750 | Protein ID | WP_277732601.1 |
Coordinates | 191594..191878 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P4S50_RS00720 (P4S50_00720) | 186608..186802 | + | 195 | WP_277732595.1 | hypothetical protein | - |
P4S50_RS00725 (P4S50_00725) | 186823..188796 | + | 1974 | WP_277732596.1 | methyl-accepting chemotaxis protein | - |
P4S50_RS00730 (P4S50_00730) | 188944..189330 | + | 387 | WP_277732597.1 | holo-ACP synthase | - |
P4S50_RS00735 (P4S50_00735) | 189333..189782 | + | 450 | WP_277732598.1 | CBS domain-containing protein | - |
P4S50_RS00740 (P4S50_00740) | 189800..190384 | + | 585 | WP_277732599.1 | germination lipoprotein GerS | - |
P4S50_RS00745 (P4S50_00745) | 190404..191564 | + | 1161 | WP_277732600.1 | alanine racemase | - |
P4S50_RS00750 (P4S50_00750) | 191594..191878 | + | 285 | WP_277732601.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
P4S50_RS00755 (P4S50_00755) | 191871..192233 | + | 363 | WP_277732602.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
P4S50_RS00760 (P4S50_00760) | 192392..192904 | + | 513 | WP_277732603.1 | hypothetical protein | - |
P4S50_RS00765 (P4S50_00765) | 193439..195499 | + | 2061 | WP_277732604.1 | DUF5693 family protein | - |
P4S50_RS00770 (P4S50_00770) | 195492..196616 | + | 1125 | WP_277732605.1 | polysaccharide pyruvyl transferase CsaB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13407.44 Da Isoelectric Point: 5.8864
>T275387 WP_277732602.1 NZ_CP120733:191871-192233 [Tepidibacter sp. SWIR-1]
VNKNLEIKRGDIFYGDLSPVIGSEQGGVRPVLIIQNDIGNKYSPTVIIAAITSQINKAKLPTHIEINANDYGLNRDSVVL
LEQVRTIDKKRLREKIGNFDEDMMKKVDEGLQISLGLFDI
VNKNLEIKRGDIFYGDLSPVIGSEQGGVRPVLIIQNDIGNKYSPTVIIAAITSQINKAKLPTHIEINANDYGLNRDSVVL
LEQVRTIDKKRLREKIGNFDEDMMKKVDEGLQISLGLFDI
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|