Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF-MazE |
| Location | 803906..804468 | Replicon | chromosome |
| Accession | NZ_CP120732 | ||
| Organism | Burkholderia vietnamiensis strain LMG16232 | ||
Toxin (Protein)
| Gene name | mazE | Uniprot ID | A0A1B4LIN8 |
| Locus tag | P4G95_RS28620 | Protein ID | WP_011879712.1 |
| Coordinates | 803906..804226 (-) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | mazF | Uniprot ID | A0A1B4LIX1 |
| Locus tag | P4G95_RS28625 | Protein ID | WP_045579168.1 |
| Coordinates | 804220..804468 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P4G95_RS28590 (P4G95_28590) | 799020..799742 | - | 723 | WP_011879718.1 | ABC transporter permease subunit | - |
| P4G95_RS28595 (P4G95_28595) | 799835..800695 | - | 861 | WP_045579531.1 | transporter substrate-binding domain-containing protein | - |
| P4G95_RS28600 (P4G95_28600) | 801005..801208 | - | 204 | Protein_712 | DUF1016 domain-containing protein | - |
| P4G95_RS28605 (P4G95_28605) | 801228..801386 | + | 159 | Protein_713 | IS3 family transposase | - |
| P4G95_RS28610 (P4G95_28610) | 801379..801570 | - | 192 | WP_124259719.1 | hypothetical protein | - |
| P4G95_RS28615 (P4G95_28615) | 802117..803236 | - | 1120 | Protein_715 | IS3-like element IS407 family transposase | - |
| P4G95_RS28620 (P4G95_28620) | 803906..804226 | - | 321 | WP_011879712.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| P4G95_RS28625 (P4G95_28625) | 804220..804468 | - | 249 | WP_045579168.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| P4G95_RS28630 (P4G95_28630) | 804676..805865 | + | 1190 | WP_155744937.1 | IS3 family transposase | - |
| P4G95_RS28635 (P4G95_28635) | 806013..807122 | - | 1110 | WP_011879708.1 | ArsO family NAD(P)H-dependent flavin-containing monooxygenase | - |
| P4G95_RS28640 (P4G95_28640) | 807160..807552 | - | 393 | WP_011879707.1 | DUF2703 domain-containing protein | - |
| P4G95_RS28645 (P4G95_28645) | 807573..807923 | - | 351 | WP_043292566.1 | ArsA-related P-loop ATPase | - |
| P4G95_RS28650 (P4G95_28650) | 808128..808271 | - | 144 | Protein_722 | helix-turn-helix domain-containing protein | - |
| P4G95_RS28655 (P4G95_28655) | 808272..808715 | - | 444 | WP_043292565.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 802117..857190 | 55073 | |
| - | inside | IScluster/Tn | - | - | 802117..812743 | 10626 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 11935.23 Da Isoelectric Point: 10.5568
>T275385 WP_011879712.1 NZ_CP120732:c804226-803906 [Burkholderia vietnamiensis]
MVMRGEVWLVALDPTLGSEIQKTRPCVVVSPPEMHDHLRTVIVAPMTSKGRPVPFRIPVTFKRKHGLILLDQIRAVDKVR
LVKKEGAVADKTLLDTLRTLQEVFAE
MVMRGEVWLVALDPTLGSEIQKTRPCVVVSPPEMHDHLRTVIVAPMTSKGRPVPFRIPVTFKRKHGLILLDQIRAVDKVR
LVKKEGAVADKTLLDTLRTLQEVFAE
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1B4LIN8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1B4LIX1 |