Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF-MazE
Location 803906..804468 Replicon chromosome
Accession NZ_CP120732
Organism Burkholderia vietnamiensis strain LMG16232

Toxin (Protein)


Gene name mazE Uniprot ID A0A1B4LIN8
Locus tag P4G95_RS28620 Protein ID WP_011879712.1
Coordinates 803906..804226 (-) Length 107 a.a.

Antitoxin (Protein)


Gene name mazF Uniprot ID A0A1B4LIX1
Locus tag P4G95_RS28625 Protein ID WP_045579168.1
Coordinates 804220..804468 (-) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P4G95_RS28590 (P4G95_28590) 799020..799742 - 723 WP_011879718.1 ABC transporter permease subunit -
P4G95_RS28595 (P4G95_28595) 799835..800695 - 861 WP_045579531.1 transporter substrate-binding domain-containing protein -
P4G95_RS28600 (P4G95_28600) 801005..801208 - 204 Protein_712 DUF1016 domain-containing protein -
P4G95_RS28605 (P4G95_28605) 801228..801386 + 159 Protein_713 IS3 family transposase -
P4G95_RS28610 (P4G95_28610) 801379..801570 - 192 WP_124259719.1 hypothetical protein -
P4G95_RS28615 (P4G95_28615) 802117..803236 - 1120 Protein_715 IS3-like element IS407 family transposase -
P4G95_RS28620 (P4G95_28620) 803906..804226 - 321 WP_011879712.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
P4G95_RS28625 (P4G95_28625) 804220..804468 - 249 WP_045579168.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
P4G95_RS28630 (P4G95_28630) 804676..805865 + 1190 WP_155744937.1 IS3 family transposase -
P4G95_RS28635 (P4G95_28635) 806013..807122 - 1110 WP_011879708.1 ArsO family NAD(P)H-dependent flavin-containing monooxygenase -
P4G95_RS28640 (P4G95_28640) 807160..807552 - 393 WP_011879707.1 DUF2703 domain-containing protein -
P4G95_RS28645 (P4G95_28645) 807573..807923 - 351 WP_043292566.1 ArsA-related P-loop ATPase -
P4G95_RS28650 (P4G95_28650) 808128..808271 - 144 Protein_722 helix-turn-helix domain-containing protein -
P4G95_RS28655 (P4G95_28655) 808272..808715 - 444 WP_043292565.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 802117..857190 55073
- inside IScluster/Tn - - 802117..812743 10626


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(4-104)

Antitoxin

SpoVT-AbrB domain

(9-44)


Sequences

Toxin        


Download         Length: 107 a.a.        Molecular weight: 11935.23 Da        Isoelectric Point: 10.5568

>T275385 WP_011879712.1 NZ_CP120732:c804226-803906 [Burkholderia vietnamiensis]
MVMRGEVWLVALDPTLGSEIQKTRPCVVVSPPEMHDHLRTVIVAPMTSKGRPVPFRIPVTFKRKHGLILLDQIRAVDKVR
LVKKEGAVADKTLLDTLRTLQEVFAE

Download         Length: 321 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 8979.19 Da        Isoelectric Point: 4.4929

>AT275385 WP_045579168.1 NZ_CP120732:c804468-804220 [Burkholderia vietnamiensis]
MKTTIRRMGNSQGVLIPKPVLAQLGLESEVEMEVENDAIVLRRPKHKAREGWAEASKALAESGDDALVMGEFSNADDAEL
AW

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1B4LIN8

Antitoxin

Source ID Structure
AlphaFold DB A0A1B4LIX1

References