Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 293396..294081 | Replicon | chromosome |
Accession | NZ_CP120732 | ||
Organism | Burkholderia vietnamiensis strain LMG16232 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | P4G95_RS26150 | Protein ID | WP_011880197.1 |
Coordinates | 293396..293830 (-) | Length | 145 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | P4G95_RS26155 | Protein ID | WP_283848963.1 |
Coordinates | 293827..294081 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P4G95_RS26135 (P4G95_26135) | 288646..289686 | - | 1041 | WP_176295575.1 | ATP-binding protein | - |
P4G95_RS26140 (P4G95_26140) | 289680..291686 | - | 2007 | WP_244127515.1 | hypothetical protein | - |
P4G95_RS26145 (P4G95_26145) | 291851..292858 | + | 1008 | WP_176295576.1 | serine hydrolase domain-containing protein | - |
P4G95_RS26150 (P4G95_26150) | 293396..293830 | - | 435 | WP_011880197.1 | PIN domain-containing protein | Toxin |
P4G95_RS26155 (P4G95_26155) | 293827..294081 | - | 255 | WP_283848963.1 | CopG family transcriptional regulator | Antitoxin |
P4G95_RS26160 (P4G95_26160) | 294851..295063 | + | 213 | WP_212170384.1 | transposase | - |
P4G95_RS26165 (P4G95_26165) | 295131..296921 | + | 1791 | WP_011880194.1 | nitrite/sulfite reductase | - |
P4G95_RS26170 (P4G95_26170) | 296918..297325 | + | 408 | WP_011880193.1 | DUF934 domain-containing protein | - |
P4G95_RS26175 (P4G95_26175) | 297340..298221 | + | 882 | WP_283848964.1 | cupin domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15721.10 Da Isoelectric Point: 7.2342
>T275384 WP_011880197.1 NZ_CP120732:c293830-293396 [Burkholderia vietnamiensis]
VITYLLDVNVLIALLDPAHVQHEPAHAWFGRVGHSAWATCPLTENGVLRIIGNPKYPNTMVSPASVAPLVVQLRSHAGHT
FWSDDVSLLDEKHVDATRLLSSAQLTDTYLLALARAHKGKLATFDRRLVVDAVPNGGKHLELIP
VITYLLDVNVLIALLDPAHVQHEPAHAWFGRVGHSAWATCPLTENGVLRIIGNPKYPNTMVSPASVAPLVVQLRSHAGHT
FWSDDVSLLDEKHVDATRLLSSAQLTDTYLLALARAHKGKLATFDRRLVVDAVPNGGKHLELIP
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|