Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
Location | 183505..184146 | Replicon | chromosome |
Accession | NZ_CP120731 | ||
Organism | Burkholderia vietnamiensis strain LMG16232 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | P4G95_RS16235 | Protein ID | WP_011881500.1 |
Coordinates | 183808..184146 (-) | Length | 113 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | P4G95_RS16230 | Protein ID | WP_011881499.1 |
Coordinates | 183505..183804 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P4G95_RS16205 (P4G95_16205) | 178612..179883 | + | 1272 | WP_059895582.1 | anthranilate 1,2-dioxygenase large subunit AndAc | - |
P4G95_RS16210 (P4G95_16210) | 179901..180386 | + | 486 | WP_034194948.1 | anthranilate 1,2-dioxygenase small subunit AndAd | - |
P4G95_RS16215 (P4G95_16215) | 180413..180739 | + | 327 | WP_011881496.1 | anthranilate 1,2-dioxygenase ferredoxin subunit AndAb | - |
P4G95_RS16220 (P4G95_16220) | 180729..181949 | + | 1221 | WP_059462396.1 | anthranilate 1,2-dioxygenase system ferredoxin--NAD(+) reductase | - |
P4G95_RS16225 (P4G95_16225) | 182138..183424 | + | 1287 | WP_011881498.1 | DUF445 domain-containing protein | - |
P4G95_RS16230 (P4G95_16230) | 183505..183804 | - | 300 | WP_011881499.1 | putative addiction module antidote protein | Antitoxin |
P4G95_RS16235 (P4G95_16235) | 183808..184146 | - | 339 | WP_011881500.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P4G95_RS16240 (P4G95_16240) | 184503..186143 | + | 1641 | WP_011881501.1 | acetolactate synthase large subunit | - |
P4G95_RS16245 (P4G95_16245) | 186172..187605 | + | 1434 | WP_011881502.1 | aldehyde dehydrogenase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 12642.42 Da Isoelectric Point: 9.4958
>T275383 WP_011881500.1 NZ_CP120731:c184146-183808 [Burkholderia vietnamiensis]
MVDISSNVPYSAPTYSIRTTEVFDTWFAGLQDRVARRRIQARIDRLSMGNPGDWKSAGSPVVEMRIDHGPGYRVYYVRRA
TIWVILLCGGDKSTQQADIRAAHAMLGRLDLE
MVDISSNVPYSAPTYSIRTTEVFDTWFAGLQDRVARRRIQARIDRLSMGNPGDWKSAGSPVVEMRIDHGPGYRVYYVRRA
TIWVILLCGGDKSTQQADIRAAHAMLGRLDLE
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|