Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapC-vagC/VapC-VagC |
| Location | 1283747..1284384 | Replicon | chromosome |
| Accession | NZ_CP120730 | ||
| Organism | Burkholderia vietnamiensis strain LMG16232 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | I2DIN1 |
| Locus tag | P4G95_RS05890 | Protein ID | WP_014722201.1 |
| Coordinates | 1283983..1284384 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | P4G95_RS05885 | Protein ID | WP_011882846.1 |
| Coordinates | 1283747..1283983 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P4G95_RS05870 (P4G95_05870) | 1279286..1280320 | + | 1035 | WP_034192975.1 | helix-turn-helix domain-containing protein | - |
| P4G95_RS05875 (P4G95_05875) | 1280647..1281768 | - | 1122 | WP_131753316.1 | ADP-heptose--LPS heptosyltransferase | - |
| P4G95_RS05880 (P4G95_05880) | 1281765..1283468 | - | 1704 | WP_059669504.1 | thiamine pyrophosphate-binding protein | - |
| P4G95_RS05885 (P4G95_05885) | 1283747..1283983 | + | 237 | WP_011882846.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| P4G95_RS05890 (P4G95_05890) | 1283983..1284384 | + | 402 | WP_014722201.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P4G95_RS05895 (P4G95_05895) | 1284452..1285840 | - | 1389 | WP_014722202.1 | L-serine ammonia-lyase | - |
| P4G95_RS05900 (P4G95_05900) | 1285871..1287007 | - | 1137 | WP_045578623.1 | alginate lyase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14908.05 Da Isoelectric Point: 5.1684
>T275382 WP_014722201.1 NZ_CP120730:1283983-1284384 [Burkholderia vietnamiensis]
MPRYMLDTNMCIYLMKSQPEQVAKRFAQCYTGDVVMSAITYAELEYGVTACAAPARERRHLAALIEDIPVAPFDAAAAQA
YGPVRDATRAWKKDHLDKLIAAHAVSLDVVLVTNDERDFTSYPGLRLENWLND
MPRYMLDTNMCIYLMKSQPEQVAKRFAQCYTGDVVMSAITYAELEYGVTACAAPARERRHLAALIEDIPVAPFDAAAAQA
YGPVRDATRAWKKDHLDKLIAAHAVSLDVVLVTNDERDFTSYPGLRLENWLND
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|