Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 201897..202464 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP120721 | ||
| Organism | Vibrio coralliilyticus strain Rb102 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | P6988_RS25935 | Protein ID | WP_277685932.1 |
| Coordinates | 202135..202464 (+) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A347UR02 |
| Locus tag | P6988_RS25930 | Protein ID | WP_005377003.1 |
| Coordinates | 201897..202145 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6988_RS25900 (P6988_25900) | 198122..198457 | - | 336 | WP_251768734.1 | helix-turn-helix transcriptional regulator | - |
| P6988_RS25905 (P6988_25905) | 199237..199716 | + | 480 | WP_171348527.1 | hypothetical protein | - |
| P6988_RS25910 (P6988_25910) | 200118..200345 | - | 228 | Protein_196 | isocitrate lyase/phosphoenolpyruvate mutase family protein | - |
| P6988_RS25915 (P6988_25915) | 200467..200913 | - | 447 | WP_277685930.1 | isoprenylcysteine carboxylmethyltransferase family protein | - |
| P6988_RS25920 (P6988_25920) | 200975..201565 | - | 591 | WP_277685931.1 | Crp/Fnr family transcriptional regulator | - |
| P6988_RS25925 (P6988_25925) | 201754..201840 | - | 87 | WP_277686050.1 | DUF3265 domain-containing protein | - |
| P6988_RS25930 (P6988_25930) | 201897..202145 | + | 249 | WP_005377003.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| P6988_RS25935 (P6988_25935) | 202135..202464 | + | 330 | WP_277685932.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P6988_RS25940 (P6988_25940) | 202938..203084 | + | 147 | WP_277685933.1 | hypothetical protein | - |
| P6988_RS25945 (P6988_25945) | 203336..203695 | - | 360 | WP_095573461.1 | hypothetical protein | - |
| P6988_RS25950 (P6988_25950) | 203894..205060 | + | 1167 | WP_277685934.1 | cyclopropane fatty acyl phospholipid synthase | - |
| P6988_RS25955 (P6988_25955) | 205550..206899 | + | 1350 | WP_277685935.1 | replicative DNA helicase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | htpB | 1..324189 | 324189 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12788.84 Da Isoelectric Point: 9.0154
>T275378 WP_277685932.1 NZ_CP120721:202135-202464 [Vibrio coralliilyticus]
MTYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSGYRLVYKVEDNEIDFCLCLLLH
YVDTISIEVTPFYQVASTQHYIHTIESNC
MTYKLDFKKSALKEWKKLGSTLQQQFKKKLIERLDNPHVPASKLSGADNMYKIKLRQSGYRLVYKVEDNEIDFCLCLLLH
YVDTISIEVTPFYQVASTQHYIHTIESNC
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|