Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 10800..11438 Replicon plasmid unnamed1
Accession NZ_CP120721
Organism Vibrio coralliilyticus strain Rb102

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag P6988_RS25010 Protein ID WP_171354267.1
Coordinates 11076..11438 (+) Length 121 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag P6988_RS25005 Protein ID WP_064487156.1
Coordinates 10800..11033 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P6988_RS24975 (P6988_24975) 6125..6532 + 408 WP_080568975.1 GFA family protein -
P6988_RS24980 (P6988_24980) 6670..6984 + 315 WP_277685997.1 hypothetical protein -
P6988_RS24985 (P6988_24985) 6999..7721 - 723 WP_277685998.1 SDR family oxidoreductase -
P6988_RS24990 (P6988_24990) 7816..8715 + 900 WP_277685999.1 LysR family transcriptional regulator -
P6988_RS24995 (P6988_24995) 8746..9498 - 753 WP_277686000.1 SDR family oxidoreductase -
P6988_RS25000 (P6988_25000) 9606..10517 + 912 WP_277686001.1 LysR family transcriptional regulator -
P6988_RS25005 (P6988_25005) 10800..11033 + 234 WP_064487156.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
P6988_RS25010 (P6988_25010) 11076..11438 + 363 WP_171354267.1 type II toxin-antitoxin system VapC family toxin Toxin
P6988_RS25015 (P6988_25015) 11674..12531 - 858 WP_171354266.1 universal stress protein -
P6988_RS25020 (P6988_25020) 12629..13972 + 1344 WP_171354265.1 magnesium transporter -
P6988_RS25025 (P6988_25025) 14036..14646 + 611 Protein_19 hypothetical protein -
P6988_RS25030 (P6988_25030) 14673..15545 + 873 WP_277686044.1 SDR family oxidoreductase -
P6988_RS25035 (P6988_25035) 15666..15913 + 248 Protein_21 helix-turn-helix transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - htpB 1..324189 324189


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(9-114)

Antitoxin

SpoVT-AbrB domain

(7-54)


Sequences

Toxin        


Download         Length: 121 a.a.        Molecular weight: 13325.37 Da        Isoelectric Point: 7.2781

>T275377 WP_171354267.1 NZ_CP120721:11076-11438 [Vibrio coralliilyticus]
MREQPITVLQKLQDVVGKQHRIVVSAITYQEMQYGLLGKKASPKHAVLVEEFLKRVDEILPWDKSAVDATTEVKRDLMAK
GTPIGNNDTAIAGHAIATGCVLVTNNTREFQRVEGLKLED

Download         Length: 363 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8991.90 Da        Isoelectric Point: 4.2797

>AT275377 WP_064487156.1 NZ_CP120721:10800-11033 [Vibrio coralliilyticus]
MRTVSIFRNGKNQTIRLPKDFEFDGVNELEIHKEGDVITLRPVRPDWLSFGNQEEANDDFMATREDGITDEGRFNFD

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References