Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 10800..11438 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP120721 | ||
| Organism | Vibrio coralliilyticus strain Rb102 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | P6988_RS25010 | Protein ID | WP_171354267.1 |
| Coordinates | 11076..11438 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | P6988_RS25005 | Protein ID | WP_064487156.1 |
| Coordinates | 10800..11033 (+) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6988_RS24975 (P6988_24975) | 6125..6532 | + | 408 | WP_080568975.1 | GFA family protein | - |
| P6988_RS24980 (P6988_24980) | 6670..6984 | + | 315 | WP_277685997.1 | hypothetical protein | - |
| P6988_RS24985 (P6988_24985) | 6999..7721 | - | 723 | WP_277685998.1 | SDR family oxidoreductase | - |
| P6988_RS24990 (P6988_24990) | 7816..8715 | + | 900 | WP_277685999.1 | LysR family transcriptional regulator | - |
| P6988_RS24995 (P6988_24995) | 8746..9498 | - | 753 | WP_277686000.1 | SDR family oxidoreductase | - |
| P6988_RS25000 (P6988_25000) | 9606..10517 | + | 912 | WP_277686001.1 | LysR family transcriptional regulator | - |
| P6988_RS25005 (P6988_25005) | 10800..11033 | + | 234 | WP_064487156.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| P6988_RS25010 (P6988_25010) | 11076..11438 | + | 363 | WP_171354267.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P6988_RS25015 (P6988_25015) | 11674..12531 | - | 858 | WP_171354266.1 | universal stress protein | - |
| P6988_RS25020 (P6988_25020) | 12629..13972 | + | 1344 | WP_171354265.1 | magnesium transporter | - |
| P6988_RS25025 (P6988_25025) | 14036..14646 | + | 611 | Protein_19 | hypothetical protein | - |
| P6988_RS25030 (P6988_25030) | 14673..15545 | + | 873 | WP_277686044.1 | SDR family oxidoreductase | - |
| P6988_RS25035 (P6988_25035) | 15666..15913 | + | 248 | Protein_21 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | htpB | 1..324189 | 324189 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13325.37 Da Isoelectric Point: 7.2781
>T275377 WP_171354267.1 NZ_CP120721:11076-11438 [Vibrio coralliilyticus]
MREQPITVLQKLQDVVGKQHRIVVSAITYQEMQYGLLGKKASPKHAVLVEEFLKRVDEILPWDKSAVDATTEVKRDLMAK
GTPIGNNDTAIAGHAIATGCVLVTNNTREFQRVEGLKLED
MREQPITVLQKLQDVVGKQHRIVVSAITYQEMQYGLLGKKASPKHAVLVEEFLKRVDEILPWDKSAVDATTEVKRDLMAK
GTPIGNNDTAIAGHAIATGCVLVTNNTREFQRVEGLKLED
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|