Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
Location | 5902980..5903615 | Replicon | chromosome |
Accession | NZ_CP120718 | ||
Organism | Paenibacillus sp. BR1-192 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | W4ARZ2 |
Locus tag | P0X86_RS26820 | Protein ID | WP_006212388.1 |
Coordinates | 5902980..5903330 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A1S2F0P6 |
Locus tag | P0X86_RS26825 | Protein ID | WP_028406492.1 |
Coordinates | 5903334..5903615 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0X86_RS26795 (P0X86_26795) | 5898301..5898651 | + | 351 | WP_009594449.1 | hypothetical protein | - |
P0X86_RS26800 (P0X86_26800) | 5898732..5898863 | + | 132 | WP_015737250.1 | cortex morphogenetic protein CmpA | - |
P0X86_RS26805 (P0X86_26805) | 5898961..5899431 | - | 471 | WP_213579677.1 | DinB family protein | - |
P0X86_RS26810 (P0X86_26810) | 5899576..5900136 | + | 561 | WP_277746901.1 | CGNR zinc finger domain-containing protein | - |
P0X86_RS26815 (P0X86_26815) | 5900341..5902557 | - | 2217 | WP_277746902.1 | Tex family protein | - |
P0X86_RS26820 (P0X86_26820) | 5902980..5903330 | - | 351 | WP_006212388.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
P0X86_RS26825 (P0X86_26825) | 5903334..5903615 | - | 282 | WP_028406492.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
P0X86_RS26830 (P0X86_26830) | 5903842..5905029 | - | 1188 | WP_213579679.1 | alanine racemase | - |
P0X86_RS26835 (P0X86_26835) | 5905302..5906414 | - | 1113 | WP_096776514.1 | outer membrane lipoprotein-sorting protein | - |
P0X86_RS26840 (P0X86_26840) | 5906678..5908006 | - | 1329 | WP_192570688.1 | MFS transporter | - |
P0X86_RS26845 (P0X86_26845) | 5908069..5908569 | - | 501 | WP_277746903.1 | winged helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12751.64 Da Isoelectric Point: 4.8265
>T275376 WP_006212388.1 NZ_CP120718:c5903330-5902980 [Paenibacillus sp. BR1-192]
VIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAASHGFDRDSVILLEQI
RTIDKQRLTDKITHLDDEMMSKVDDSLQISLGLIDF
VIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAASHGFDRDSVILLEQI
RTIDKQRLTDKITHLDDEMMSKVDDSLQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1S2EZN8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1S2F0P6 |