Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 3882782..3883699 | Replicon | chromosome |
Accession | NZ_CP120711 | ||
Organism | Bacillus velezensis strain 12Y |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | I2HQ15 |
Locus tag | P0M29_RS20120 | Protein ID | WP_007407256.1 |
Coordinates | 3882953..3883699 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | P0M29_RS20115 | Protein ID | WP_003154807.1 |
Coordinates | 3882782..3882952 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0M29_RS20075 (3877994) | 3877994..3879583 | + | 1590 | WP_029973066.1 | hypothetical protein | - |
P0M29_RS20080 (3879596) | 3879596..3880021 | + | 426 | WP_029973065.1 | hypothetical protein | - |
P0M29_RS20085 (3880026) | 3880026..3880223 | + | 198 | WP_007610833.1 | XkdX family protein | - |
P0M29_RS20090 (3880280) | 3880280..3881041 | + | 762 | WP_029973064.1 | hypothetical protein | - |
P0M29_RS20095 (3881093) | 3881093..3881356 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
P0M29_RS20100 (3881370) | 3881370..3881633 | + | 264 | WP_003154813.1 | phage holin | - |
P0M29_RS20105 (3881647) | 3881647..3882525 | + | 879 | WP_007407257.1 | N-acetylmuramoyl-L-alanine amidase | - |
P0M29_RS20110 (3882560) | 3882560..3882685 | - | 126 | WP_003154809.1 | hypothetical protein | - |
P0M29_RS20115 (3882782) | 3882782..3882952 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
P0M29_RS20120 (3882953) | 3882953..3883699 | - | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
P0M29_RS20125 (3883803) | 3883803..3884801 | - | 999 | WP_003154805.1 | inorganic phosphate transporter | - |
P0M29_RS20130 (3884814) | 3884814..3885431 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
P0M29_RS20135 (3885717) | 3885717..3887033 | - | 1317 | WP_007610842.1 | amino acid permease | - |
P0M29_RS20140 (3887355) | 3887355..3888305 | + | 951 | WP_007610844.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T275375 WP_007407256.1 NZ_CP120711:c3883699-3882953 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|