Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3033528..3034165 | Replicon | chromosome |
Accession | NZ_CP120711 | ||
Organism | Bacillus velezensis strain 12Y |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | P0M29_RS15455 | Protein ID | WP_003156187.1 |
Coordinates | 3033815..3034165 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | P0M29_RS15450 | Protein ID | WP_003156188.1 |
Coordinates | 3033528..3033809 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P0M29_RS15430 (3029893) | 3029893..3030492 | - | 600 | WP_029974099.1 | rhomboid family intramembrane serine protease | - |
P0M29_RS15435 (3030585) | 3030585..3030950 | + | 366 | WP_007609580.1 | holo-ACP synthase | - |
P0M29_RS15440 (3031115) | 3031115..3032122 | + | 1008 | WP_007410230.1 | outer membrane lipoprotein carrier protein LolA | - |
P0M29_RS15445 (3032239) | 3032239..3033408 | + | 1170 | WP_021495079.1 | alanine racemase | - |
P0M29_RS15450 (3033528) | 3033528..3033809 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
P0M29_RS15455 (3033815) | 3033815..3034165 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
P0M29_RS15460 (3034283) | 3034283..3035104 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
P0M29_RS15465 (3035109) | 3035109..3035474 | + | 366 | WP_007609584.1 | RsbT antagonist protein RsbS | - |
P0M29_RS15470 (3035477) | 3035477..3035878 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
P0M29_RS15475 (3035890) | 3035890..3036897 | + | 1008 | WP_007609589.1 | PP2C family protein-serine/threonine phosphatase | - |
P0M29_RS15480 (3036961) | 3036961..3037290 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
P0M29_RS15485 (3037287) | 3037287..3037769 | + | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
P0M29_RS15490 (3037735) | 3037735..3038523 | + | 789 | WP_029974100.1 | RNA polymerase sigma factor SigB | - |
P0M29_RS15495 (3038523) | 3038523..3039125 | + | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T275374 WP_003156187.1 NZ_CP120711:3033815-3034165 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|