Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 732880..733531 | Replicon | chromosome |
Accession | NZ_CP120687 | ||
Organism | Lacticaseibacillus sp. DSM 115425 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | K8Q4Y0 |
Locus tag | LHUE1_RS03275 | Protein ID | WP_005686631.1 |
Coordinates | 732880..733263 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A0R1EMB2 |
Locus tag | LHUE1_RS03280 | Protein ID | WP_010491246.1 |
Coordinates | 733283..733531 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LHUE1_RS03255 (LHUE1_000651) | 728359..729366 | + | 1008 | WP_003662706.1 | L-lactate dehydrogenase | - |
LHUE1_RS03260 (LHUE1_000652) | 729673..731043 | + | 1371 | WP_049170368.1 | L,D-transpeptidase family protein | - |
LHUE1_RS03265 (LHUE1_000653) | 731251..731916 | + | 666 | WP_010491258.1 | cyclic di-AMP binding protein CbpA | - |
LHUE1_RS03270 (LHUE1_000654) | 732112..732810 | + | 699 | WP_049170367.1 | L,D-transpeptidase | - |
LHUE1_RS03275 (LHUE1_000655) | 732880..733263 | - | 384 | WP_005686631.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
LHUE1_RS03280 (LHUE1_000656) | 733283..733531 | - | 249 | WP_010491246.1 | antitoxin | Antitoxin |
LHUE1_RS03285 (LHUE1_000657) | 733630..734769 | - | 1140 | WP_049170365.1 | alanine racemase | - |
LHUE1_RS03290 (LHUE1_000658) | 734756..735130 | - | 375 | WP_049170363.1 | holo-ACP synthase | - |
LHUE1_RS03295 (LHUE1_000659) | 735377..736888 | - | 1512 | WP_049170360.1 | DEAD/DEAH box helicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 13757.03 Da Isoelectric Point: 10.9764
>T275370 WP_005686631.1 NZ_CP120687:c733263-732880 [Lacticaseibacillus sp. DSM 115425]
MDVTVKRGDVFFADLSPVVGSEQGGNRPVLIIQNNVGNHYSPTVIVAAITSKIQKPKMPTHVGLRAKQDGVERNSVILLE
QIRTIDKQRLQARVTALSSAKMAAVDRALAISVGLVSLPKPKTYNKN
MDVTVKRGDVFFADLSPVVGSEQGGNRPVLIIQNNVGNHYSPTVIVAAITSKIQKPKMPTHVGLRAKQDGVERNSVILLE
QIRTIDKQRLQARVTALSSAKMAAVDRALAISVGLVSLPKPKTYNKN
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | K8Q4Y0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R1EMB2 |