Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 4099037..4099673 | Replicon | chromosome |
Accession | NZ_CP120681 | ||
Organism | Bacillus subtilis strain DSM 10 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | P5655_RS21925 | Protein ID | WP_003156187.1 |
Coordinates | 4099323..4099673 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | P5655_RS21920 | Protein ID | WP_003225183.1 |
Coordinates | 4099037..4099318 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5655_RS21900 (4095396) | 4095396..4095995 | - | 600 | WP_003246687.1 | rhomboid family intramembrane serine protease | - |
P5655_RS21905 (4096090) | 4096090..4096455 | + | 366 | WP_003234281.1 | holo-ACP synthase | - |
P5655_RS21910 (4096621) | 4096621..4097637 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
P5655_RS21915 (4097752) | 4097752..4098921 | + | 1170 | WP_003234284.1 | alanine racemase | - |
P5655_RS21920 (4099037) | 4099037..4099318 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
P5655_RS21925 (4099323) | 4099323..4099673 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
P5655_RS21930 (4099788) | 4099788..4100612 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
P5655_RS21935 (4100617) | 4100617..4100982 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
P5655_RS21940 (4100986) | 4100986..4101387 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
P5655_RS21945 (4101399) | 4101399..4102406 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
P5655_RS21950 (4102468) | 4102468..4102797 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
P5655_RS21955 (4102794) | 4102794..4103276 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
P5655_RS21960 (4103242) | 4103242..4104030 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
P5655_RS21965 (4104030) | 4104030..4104629 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T275369 WP_003156187.1 NZ_CP120681:4099323-4099673 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|