Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 713161..714077 | Replicon | chromosome |
Accession | NZ_CP120681 | ||
Organism | Bacillus subtilis strain DSM 10 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | P5655_RS04240 | Protein ID | WP_003244695.1 |
Coordinates | 713331..714077 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | P5655_RS04235 | Protein ID | WP_003232646.1 |
Coordinates | 713161..713331 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5655_RS04200 (710024) | 710024..710353 | + | 330 | WP_003232660.1 | XkdW family protein | - |
P5655_RS04205 (710350) | 710350..710514 | + | 165 | WP_003232658.1 | XkdX family protein | - |
P5655_RS04210 (710558) | 710558..711397 | + | 840 | WP_003245597.1 | phage-like element PBSX protein XepA | - |
P5655_RS04215 (711450) | 711450..711719 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
P5655_RS04220 (711732) | 711732..711995 | + | 264 | WP_003232653.1 | phage holin | - |
P5655_RS04225 (712008) | 712008..712901 | + | 894 | WP_003245230.1 | N-acetylmuramoyl-L-alanine amidase | - |
P5655_RS04230 (712938) | 712938..713075 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
P5655_RS04235 (713161) | 713161..713331 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
P5655_RS04240 (713331) | 713331..714077 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
P5655_RS04245 (714187) | 714187..715188 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
P5655_RS04250 (715201) | 715201..715818 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
P5655_RS04255 (716094) | 716094..717410 | - | 1317 | WP_003244819.1 | serine/threonine exchanger | - |
P5655_RS04260 (717799) | 717799..718749 | + | 951 | WP_003245086.1 | ring-cleaving dioxygenase | - |
P5655_RS04265 (718850) | 718850..718996 | + | 147 | WP_003244977.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T275349 WP_003244695.1 NZ_CP120681:c714077-713331 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|