Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 620632..621268 Replicon chromosome
Accession NZ_CP120679
Organism Bacillus sp. HSf4

Toxin (Protein)


Gene name mazF Uniprot ID M5P3Q9
Locus tag P3X63_RS03080 Protein ID WP_003179128.1
Coordinates 620918..621268 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A6I7F8B4
Locus tag P3X63_RS03075 Protein ID WP_026585993.1
Coordinates 620632..620913 (+) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P3X63_RS03055 (P3X63_03055) 615777..617264 + 1488 WP_026585989.1 PH domain-containing protein -
P3X63_RS03060 (P3X63_03060) 617258..617857 - 600 WP_077735676.1 rhomboid family intramembrane serine protease -
P3X63_RS03065 (P3X63_03065) 618134..619150 + 1017 WP_142246052.1 outer membrane lipoprotein carrier protein LolA -
P3X63_RS03070 (P3X63_03070) 619358..620527 + 1170 WP_026585992.1 alanine racemase -
P3X63_RS03075 (P3X63_03075) 620632..620913 + 282 WP_026585993.1 hypothetical protein Antitoxin
P3X63_RS03080 (P3X63_03080) 620918..621268 + 351 WP_003179128.1 type II toxin-antitoxin system endoribonuclease NdoA Toxin
P3X63_RS03085 (P3X63_03085) 621386..622213 + 828 WP_077735675.1 RsbT co-antagonist protein RsbRA -
P3X63_RS03090 (P3X63_03090) 622217..622582 + 366 WP_026585995.1 STAS domain-containing protein -
P3X63_RS03095 (P3X63_03095) 622585..622986 + 402 WP_026585996.1 anti-sigma regulatory factor -
P3X63_RS03100 (P3X63_03100) 622997..624004 + 1008 WP_026585997.1 PP2C family protein-serine/threonine phosphatase -
P3X63_RS03105 (P3X63_03105) 624063..624389 + 327 WP_026585998.1 anti-sigma factor antagonist -
P3X63_RS03110 (P3X63_03110) 624389..624871 + 483 WP_026585999.1 anti-sigma B factor RsbW -
P3X63_RS03115 (P3X63_03115) 624837..625628 + 792 WP_026586000.1 RNA polymerase sigma factor SigB -
P3X63_RS03120 (P3X63_03120) 625625..626224 + 600 WP_026586001.1 PP2C family serine/threonine-protein phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(1-113)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 12990.03 Da        Isoelectric Point: 5.7234

>T275347 WP_003179128.1 NZ_CP120679:620918-621268 [Bacillus sp. HSf4]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF

Download         Length: 351 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10667.07 Da        Isoelectric Point: 4.6920

>AT275347 WP_026585993.1 NZ_CP120679:620632-620913 [Bacillus sp. HSf4]
MSESSATTEIMIRLPEALVSELDGVVMQDNGSRNELIYQATKMYLRERKNRQIRESMRRGYMEMAKINLNISSEAQFAEY
EAENTVERLVSGG

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6I7FHI4

Antitoxin

Source ID Structure
AlphaFold DB A0A6I7F8B4

References