Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 2114766..2115337 | Replicon | chromosome |
| Accession | NZ_CP120677 | ||
| Organism | Tissierella sp. Yu-01 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | P3962_RS10830 | Protein ID | WP_277719457.1 |
| Coordinates | 2115005..2115337 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | P3962_RS10825 | Protein ID | WP_277719456.1 |
| Coordinates | 2114766..2115005 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3962_RS10805 (P3962_10805) | 2111227..2111469 | - | 243 | WP_277719452.1 | hypothetical protein | - |
| P3962_RS10810 (P3962_10810) | 2111628..2112629 | - | 1002 | WP_277719453.1 | ATP-binding cassette domain-containing protein | - |
| P3962_RS10815 (P3962_10815) | 2112622..2113323 | - | 702 | WP_277719454.1 | GTP-binding protein | - |
| P3962_RS10820 (P3962_10820) | 2113336..2114568 | - | 1233 | WP_277719455.1 | ABC transporter substrate-binding protein | - |
| P3962_RS10825 (P3962_10825) | 2114766..2115005 | + | 240 | WP_277719456.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| P3962_RS10830 (P3962_10830) | 2115005..2115337 | + | 333 | WP_277719457.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| P3962_RS10835 (P3962_10835) | 2115405..2115791 | + | 387 | WP_277719458.1 | DUF302 domain-containing protein | - |
| P3962_RS10840 (P3962_10840) | 2115842..2117128 | - | 1287 | WP_277719459.1 | copper amine oxidase N-terminal domain-containing protein | - |
| P3962_RS10845 (P3962_10845) | 2117292..2117474 | - | 183 | WP_277719460.1 | hypothetical protein | - |
| P3962_RS10850 (P3962_10850) | 2117541..2117783 | - | 243 | WP_277719461.1 | DUF2249 domain-containing protein | - |
| P3962_RS10855 (P3962_10855) | 2118124..2118708 | - | 585 | WP_277719462.1 | accessory gene regulator B family protein | - |
| P3962_RS10860 (P3962_10860) | 2119277..2120215 | - | 939 | WP_277719463.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12600.52 Da Isoelectric Point: 5.7225
>T275346 WP_277719457.1 NZ_CP120677:2115005-2115337 [Tissierella sp. Yu-01]
MTYIPEQGDIIFIEFNPQVGHEQKGKRPALVVSNYTFNKFTKLAMLCPITNTDRSFPLHVKLDERTKTTGVIMCEQVKSL
DYNARAISFYERSPEDIVAEVKDVLLGFIE
MTYIPEQGDIIFIEFNPQVGHEQKGKRPALVVSNYTFNKFTKLAMLCPITNTDRSFPLHVKLDERTKTTGVIMCEQVKSL
DYNARAISFYERSPEDIVAEVKDVLLGFIE
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|