Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 4165405..4165927 | Replicon | chromosome |
Accession | NZ_CP120671 | ||
Organism | Salmonella enterica strain SC2020597 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | P4B13_RS20075 | Protein ID | WP_000221343.1 |
Coordinates | 4165405..4165689 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | P4B13_RS20080 | Protein ID | WP_000885424.1 |
Coordinates | 4165679..4165927 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P4B13_RS20055 (4161480) | 4161480..4162988 | - | 1509 | WP_017465709.1 | FAD-dependent oxidoreductase | - |
P4B13_RS20060 (4163033) | 4163033..4163521 | + | 489 | WP_017465710.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
P4B13_RS20065 (4163714) | 4163714..4164793 | + | 1080 | WP_017465711.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
P4B13_RS20070 (4164845) | 4164845..4165234 | - | 390 | WP_000194089.1 | RidA family protein | - |
P4B13_RS20075 (4165405) | 4165405..4165689 | - | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P4B13_RS20080 (4165679) | 4165679..4165927 | - | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
P4B13_RS20085 (4166075) | 4166075..4166530 | - | 456 | Protein_3913 | helix-turn-helix domain-containing protein | - |
P4B13_RS20090 (4166883) | 4166883..4167173 | - | 291 | WP_000742001.1 | hypothetical protein | - |
P4B13_RS20095 (4167475) | 4167475..4168941 | - | 1467 | WP_000987828.1 | hypothetical protein | - |
P4B13_RS20100 (4169199) | 4169199..4170206 | + | 1008 | WP_000201074.1 | LacI family DNA-binding transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4160043..4168938 | 8895 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T275341 WP_000221343.1 NZ_CP120671:c4165689-4165405 [Salmonella enterica]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |