Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3117445..3118065 | Replicon | chromosome |
Accession | NZ_CP120671 | ||
Organism | Salmonella enterica strain SC2020597 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | P4B13_RS14830 | Protein ID | WP_001280991.1 |
Coordinates | 3117445..3117663 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | P4B13_RS14835 | Protein ID | WP_000344807.1 |
Coordinates | 3117691..3118065 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P4B13_RS14790 (3112668) | 3112668..3113237 | + | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
P4B13_RS14795 (3113270) | 3113270..3113659 | - | 390 | WP_000961285.1 | MGMT family protein | - |
P4B13_RS14805 (3113890) | 3113890..3115440 | - | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
P4B13_RS14810 (3115665) | 3115665..3115925 | + | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
P4B13_RS14815 (3115931) | 3115931..3116071 | + | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
P4B13_RS14820 (3116127) | 3116127..3116597 | - | 471 | WP_000136183.1 | YlaC family protein | - |
P4B13_RS14825 (3116715) | 3116715..3117266 | - | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
P4B13_RS14830 (3117445) | 3117445..3117663 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
P4B13_RS14835 (3117691) | 3117691..3118065 | - | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
P4B13_RS14840 (3118561) | 3118561..3121710 | - | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
P4B13_RS14845 (3121733) | 3121733..3122926 | - | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T275340 WP_001280991.1 NZ_CP120671:c3117663-3117445 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT275340 WP_000344807.1 NZ_CP120671:c3118065-3117691 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|