Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2408904..2409420 | Replicon | chromosome |
Accession | NZ_CP120671 | ||
Organism | Salmonella enterica strain SC2020597 |
Toxin (Protein)
Gene name | relE | Uniprot ID | C0Q7A9 |
Locus tag | P4B13_RS11535 | Protein ID | WP_000220578.1 |
Coordinates | 2409136..2409420 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | P4B13_RS11530 | Protein ID | WP_000212724.1 |
Coordinates | 2408904..2409146 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P4B13_RS11510 (2403924) | 2403924..2405057 | + | 1134 | WP_017465838.1 | amidohydrolase/deacetylase family metallohydrolase | - |
P4B13_RS11515 (2405041) | 2405041..2406159 | + | 1119 | WP_017465839.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
P4B13_RS11520 (2406156) | 2406156..2406896 | + | 741 | WP_023193113.1 | KDGP aldolase family protein | - |
P4B13_RS11525 (2406913) | 2406913..2408826 | + | 1914 | WP_001212135.1 | BglG family transcription antiterminator | - |
P4B13_RS11530 (2408904) | 2408904..2409146 | + | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
P4B13_RS11535 (2409136) | 2409136..2409420 | + | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P4B13_RS11540 (2409424) | 2409424..2409888 | - | 465 | WP_017465840.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
P4B13_RS11545 (2410105) | 2410105..2412243 | - | 2139 | WP_000187821.1 | anaerobic ribonucleoside-triphosphate reductase | - |
P4B13_RS11550 (2412652) | 2412652..2414304 | - | 1653 | WP_000155049.1 | alpha,alpha-phosphotrehalase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T275337 WP_000220578.1 NZ_CP120671:2409136-2409420 [Salmonella enterica]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E876 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |