Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1232089..1232849 | Replicon | chromosome |
Accession | NZ_CP120671 | ||
Organism | Salmonella enterica strain SC2020597 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | Q57IH1 |
Locus tag | P4B13_RS05830 | Protein ID | WP_000533909.1 |
Coordinates | 1232089..1232574 (-) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | M7RHS4 |
Locus tag | P4B13_RS05835 | Protein ID | WP_000965886.1 |
Coordinates | 1232562..1232849 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P4B13_RS05800 (1227159) | 1227159..1227821 | + | 663 | WP_000747548.1 | OmpA family lipoprotein | - |
P4B13_RS05805 (1228040) | 1228040..1229014 | + | 975 | WP_017465308.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
P4B13_RS05810 (1229064) | 1229064..1229774 | - | 711 | WP_000190524.1 | DUF3053 domain-containing protein | - |
P4B13_RS05815 (1230213) | 1230213..1230503 | + | 291 | WP_000455790.1 | HTH-type transcriptional regulator | - |
P4B13_RS05820 (1230791) | 1230791..1231003 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
P4B13_RS05825 (1231176) | 1231176..1231715 | + | 540 | WP_000047140.1 | copper-binding periplasmic metallochaperone CueP | - |
P4B13_RS05830 (1232089) | 1232089..1232574 | - | 486 | WP_000533909.1 | GNAT family N-acetyltransferase | Toxin |
P4B13_RS05835 (1232562) | 1232562..1232849 | - | 288 | WP_000965886.1 | DUF1778 domain-containing protein | Antitoxin |
P4B13_RS05840 (1233027) | 1233027..1233494 | - | 468 | WP_000702452.1 | GNAT family N-acetyltransferase | - |
P4B13_RS05845 (1233666) | 1233666..1234064 | - | 399 | Protein_1133 | IS3 family transposase | - |
P4B13_RS05850 (1234454) | 1234454..1236523 | - | 2070 | WP_001291736.1 | glycine--tRNA ligase subunit beta | - |
P4B13_RS05855 (1236533) | 1236533..1237444 | - | 912 | WP_001168551.1 | glycine--tRNA ligase subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17703.41 Da Isoelectric Point: 9.8719
>T275333 WP_000533909.1 NZ_CP120671:c1232574-1232089 [Salmonella enterica]
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7F36 | |
PDB | 7AK8 | |
PDB | 5FVJ |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK8 | |
AlphaFold DB | A0A3V2JDX2 |