Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 1121970..1122556 Replicon chromosome
Accession NZ_CP120671
Organism Salmonella enterica strain SC2020597

Toxin (Protein)


Gene name doc Uniprot ID A0A5V1HI31
Locus tag P4B13_RS05340 Protein ID WP_000174965.1
Coordinates 1121970..1122338 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A8F2ZY79
Locus tag P4B13_RS05345 Protein ID WP_001599562.1
Coordinates 1122335..1122556 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P4B13_RS05320 (1117489) 1117489..1118559 - 1071 WP_000907838.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
P4B13_RS05325 (1118561) 1118561..1119406 - 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
P4B13_RS05330 (1119403) 1119403..1120290 - 888 WP_000094074.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
P4B13_RS05335 (1120395) 1120395..1121711 - 1317 WP_017465332.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
P4B13_RS05340 (1121970) 1121970..1122338 - 369 WP_000174965.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
P4B13_RS05345 (1122335) 1122335..1122556 - 222 WP_001599562.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
P4B13_RS05350 (1122688) 1122688..1123401 - 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
P4B13_RS05355 (1123403) 1123403..1124170 - 768 WP_017465331.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
P4B13_RS05360 (1124167) 1124167..1125444 - 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
P4B13_RS05365 (1125441) 1125441..1126367 - 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
P4B13_RS05370 (1126427) 1126427..1127536 - 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1116323..1125444 9121


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(24-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13599.89 Da        Isoelectric Point: 6.4657

>T275332 WP_000174965.1 NZ_CP120671:c1122338-1121970 [Salmonella enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.20 Da        Isoelectric Point: 6.4643

>AT275332 WP_001599562.1 NZ_CP120671:c1122556-1122335 [Salmonella enterica]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRKLADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5V1HI31

Antitoxin

Source ID Structure

References