Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 602462..603122 | Replicon | chromosome |
| Accession | NZ_CP120671 | ||
| Organism | Salmonella enterica strain SC2020597 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | Q57K70 |
| Locus tag | P4B13_RS02750 | Protein ID | WP_000244756.1 |
| Coordinates | 602462..602875 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S5MU13 |
| Locus tag | P4B13_RS02755 | Protein ID | WP_000351186.1 |
| Coordinates | 602856..603122 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P4B13_RS02730 (598403) | 598403..600136 | - | 1734 | WP_017465473.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| P4B13_RS02735 (600142) | 600142..600855 | - | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| P4B13_RS02740 (600879) | 600879..601775 | - | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
| P4B13_RS02745 (601888) | 601888..602409 | + | 522 | WP_001055885.1 | flavodoxin FldB | - |
| P4B13_RS02750 (602462) | 602462..602875 | - | 414 | WP_000244756.1 | protein YgfX | Toxin |
| P4B13_RS02755 (602856) | 602856..603122 | - | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
| P4B13_RS02760 (603372) | 603372..604352 | + | 981 | WP_000874178.1 | tRNA-modifying protein YgfZ | - |
| P4B13_RS02765 (604468) | 604468..605127 | - | 660 | WP_000250289.1 | hemolysin III family protein | - |
| P4B13_RS02770 (605292) | 605292..605603 | - | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
| P4B13_RS02775 (605762) | 605762..607195 | + | 1434 | WP_017465472.1 | 6-phospho-beta-glucosidase BglA | - |
| P4B13_RS02780 (607243) | 607243..607944 | - | 702 | WP_277738631.1 | transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16183.15 Da Isoelectric Point: 10.7537
>T275331 WP_000244756.1 NZ_CP120671:c602875-602462 [Salmonella enterica]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z1E9V5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0YWH4 |