Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 591578..592203 | Replicon | chromosome |
Accession | NZ_CP120671 | ||
Organism | Salmonella enterica strain SC2020597 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A5I5T1K0 |
Locus tag | P4B13_RS02685 | Protein ID | WP_001748684.1 |
Coordinates | 591578..591976 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | C0PXM4 |
Locus tag | P4B13_RS02690 | Protein ID | WP_000557545.1 |
Coordinates | 591976..592203 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P4B13_RS02670 (588251) | 588251..588838 | - | 588 | WP_001244643.1 | fimbrial protein | - |
P4B13_RS02675 (589557) | 589557..590189 | - | 633 | WP_000835265.1 | YfdX family protein | - |
P4B13_RS02680 (590236) | 590236..590772 | - | 537 | WP_017465475.1 | STM3031 family outer membrane protein | - |
P4B13_RS02685 (591578) | 591578..591976 | - | 399 | WP_001748684.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
P4B13_RS02690 (591976) | 591976..592203 | - | 228 | WP_000557545.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
P4B13_RS02695 (592412) | 592412..592663 | + | 252 | WP_001748683.1 | hypothetical protein | - |
P4B13_RS02700 (592938) | 592938..593744 | + | 807 | WP_077907190.1 | DUF1460 domain-containing protein | - |
P4B13_RS02710 (594029) | 594029..594787 | - | 759 | WP_000244328.1 | amidase activator ActS | - |
P4B13_RS02715 (595052) | 595052..595597 | + | 546 | WP_000133986.1 | isopentenyl-diphosphate Delta-isomerase | - |
P4B13_RS02720 (595673) | 595673..597190 | - | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14995.39 Da Isoelectric Point: 7.7780
>T275330 WP_001748684.1 NZ_CP120671:c591976-591578 [Salmonella enterica]
MLKFMLDTNTCIFTIKNKPEHVKERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHVKERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I5T1K0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9MGW6 |