Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 434564..435378 | Replicon | chromosome |
| Accession | NZ_CP120671 | ||
| Organism | Salmonella enterica strain SC2020597 | ||
Toxin (Protein)
| Gene name | TacT3 | Uniprot ID | Q57KM2 |
| Locus tag | P4B13_RS01980 | Protein ID | WP_000971655.1 |
| Coordinates | 434851..435378 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | TacA3 | Uniprot ID | M7S6I2 |
| Locus tag | P4B13_RS01975 | Protein ID | WP_000855694.1 |
| Coordinates | 434564..434854 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P4B13_RS01945 (430515) | 430515..431165 | - | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
| P4B13_RS01950 (431621) | 431621..432064 | + | 444 | WP_000715096.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
| P4B13_RS01955 (432495) | 432495..432944 | + | 450 | WP_000381612.1 | membrane protein | - |
| P4B13_RS01960 (432929) | 432929..433276 | + | 348 | WP_023198553.1 | DUF1493 family protein | - |
| P4B13_RS01965 (433549) | 433549..433875 | - | 327 | WP_000393302.1 | hypothetical protein | - |
| P4B13_RS01970 (434116) | 434116..434294 | + | 179 | Protein_377 | IS3 family transposase | - |
| P4B13_RS01975 (434564) | 434564..434854 | + | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
| P4B13_RS01980 (434851) | 434851..435378 | + | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
| P4B13_RS01985 (435451) | 435451..435860 | - | 410 | Protein_380 | IS5/IS1182 family transposase | - |
| P4B13_RS01990 (436093) | 436093..436749 | + | 657 | WP_001748710.1 | protein-serine/threonine phosphatase | - |
| P4B13_RS01995 (436994) | 436994..437488 | - | 495 | WP_000424947.1 | hypothetical protein | - |
| P4B13_RS02000 (437515) | 437515..438183 | - | 669 | WP_000445914.1 | hypothetical protein | - |
| P4B13_RS02005 (438340) | 438340..438579 | - | 240 | Protein_384 | hypothetical protein | - |
| P4B13_RS02010 (438770) | 438770..439168 | - | 399 | Protein_385 | cytoplasmic protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 435451..435591 | 140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T275329 WP_000971655.1 NZ_CP120671:434851-435378 [Salmonella enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6G96 | |
| PDB | 7AK9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3V8SJE7 |