Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Xre-MNT/HTH_26(antitoxin)
Location 672598..673706 Replicon chromosome
Accession NZ_CP120654
Organism Streptococcus agalactiae strain Guangzhou-SAG036

Toxin (Protein)


Gene name MNTss Uniprot ID A0A3S8RBH6
Locus tag P3L36_RS03730 Protein ID WP_071661597.1
Coordinates 672837..673706 (+) Length 290 a.a.

Antitoxin (Protein)


Gene name Xress Uniprot ID -
Locus tag P3L36_RS03725 Protein ID WP_277687628.1
Coordinates 672598..672822 (+) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P3L36_RS03690 (P3L36_03690) 667814..667984 + 171 WP_004614788.1 cysteine-rich KTR domain-containing protein -
P3L36_RS03695 (P3L36_03695) 668187..668357 + 171 WP_000713595.1 hypothetical protein -
P3L36_RS03700 (P3L36_03700) 668371..668973 + 603 WP_001062586.1 recombinase family protein -
P3L36_RS03705 (P3L36_03705) 668989..669666 + 678 Protein_646 DNA topoisomerase -
P3L36_RS03710 (P3L36_03710) 669977..670474 + 498 WP_002327635.1 DNA recombinase -
P3L36_RS03715 (P3L36_03715) 670475..670891 + 417 WP_000323438.1 recombinase -
P3L36_RS03720 (P3L36_03720) 670911..672455 + 1545 WP_002390960.1 recombinase family protein -
P3L36_RS03725 (P3L36_03725) 672598..672822 + 225 WP_277687628.1 helix-turn-helix transcriptional regulator Antitoxin
P3L36_RS03730 (P3L36_03730) 672837..673706 + 870 WP_071661597.1 nucleotidyltransferase domain-containing protein Toxin
P3L36_RS03735 (P3L36_03735) 673687..674421 + 735 WP_000662263.1 class I SAM-dependent methyltransferase -
P3L36_RS03740 (P3L36_03740) 674454..675362 + 909 WP_001255866.1 aminoglycoside nucleotidyltransferase ANT(6)-Ia -
P3L36_RS03745 (P3L36_03745) 675359..675559 + 201 Protein_654 hypothetical protein -
P3L36_RS03750 (P3L36_03750) 675639..676801 + 1163 WP_088186165.1 IS3-like element ISSag12 family transposase -
P3L36_RS03755 (P3L36_03755) 676960..677211 + 252 Protein_656 GNAT family N-acetyltransferase -
P3L36_RS03760 (P3L36_03760) 677304..678098 + 795 WP_001096887.1 aminoglycoside O-phosphotransferase APH(3')-IIIa -
P3L36_RS03765 (P3L36_03765) 678508..678591 + 84 Protein_658 MLS leader peptide -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element tet(O) / ant(6)-Ia / aph(3')-III / erm(B) cylX / cylD / cylG / acpC / cylZ / cylA / cylB / cylE / cylF / cylI / cylJ / cylK 611846..727472 115626


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Polymerase, nucleotidyl transferase domain

(12-111)

Antitoxin

Cro/C1-type helix-turn-helix domain

(4-57)


Sequences

Toxin        


Download         Length: 290 a.a.        Molecular weight: 32902.55 Da        Isoelectric Point: 4.9770

>T275327 WP_071661597.1 NZ_CP120654:672837-673706 [Streptococcus agalactiae]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEHKPEKYTE
KVNHIFEVLGISLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI

Download         Length: 870 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8293.62 Da        Isoelectric Point: 4.7228

>AT275327 WP_277687628.1 NZ_CP120654:672598-672822 [Streptococcus agalactiae]
MTTAEMIKELCEQMNISVSELARRIGQTPQNFNKKLQRETVTLDELKAIADVLGVKFVQAFILPDGEEIKISNG

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3S8RBH6

Antitoxin

Source ID Structure

References