Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1266179..1267096 | Replicon | chromosome |
Accession | NZ_CP120641 | ||
Organism | Bacillus velezensis strain YL2021 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | I2HQ15 |
Locus tag | P6S76_RS06430 | Protein ID | WP_007407256.1 |
Coordinates | 1266350..1267096 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | P6S76_RS06425 | Protein ID | WP_003154807.1 |
Coordinates | 1266179..1266349 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6S76_RS06390 | 1261413..1263035 | + | 1623 | WP_007407261.1 | pyocin knob domain-containing protein | - |
P6S76_RS06395 | 1263048..1263419 | + | 372 | WP_007407260.1 | XkdW family protein | - |
P6S76_RS06400 | 1263424..1263621 | + | 198 | WP_007407259.1 | XkdX family protein | - |
P6S76_RS06405 | 1263678..1264439 | + | 762 | WP_007407258.1 | hypothetical protein | - |
P6S76_RS06410 | 1264491..1264754 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
P6S76_RS06415 | 1264768..1265031 | + | 264 | WP_003154813.1 | phage holin | - |
P6S76_RS06420 | 1265045..1265923 | + | 879 | WP_007407257.1 | N-acetylmuramoyl-L-alanine amidase | - |
P6S76_RS06425 | 1266179..1266349 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
P6S76_RS06430 | 1266350..1267096 | - | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
P6S76_RS06435 | 1267201..1268199 | - | 999 | WP_007407255.1 | inorganic phosphate transporter | - |
P6S76_RS06440 | 1268212..1268829 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
P6S76_RS06445 | 1269115..1270431 | - | 1317 | WP_007407254.1 | amino acid permease | - |
P6S76_RS06450 | 1270754..1271704 | + | 951 | WP_007407253.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1232446..1275361 | 42915 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T275325 WP_007407256.1 NZ_CP120641:c1267096-1266350 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|