Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 532890..533527 | Replicon | chromosome |
| Accession | NZ_CP120641 | ||
| Organism | Bacillus velezensis strain YL2021 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | P6S76_RS02525 | Protein ID | WP_003156187.1 |
| Coordinates | 533177..533527 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | I2HMS5 |
| Locus tag | P6S76_RS02520 | Protein ID | WP_003156188.1 |
| Coordinates | 532890..533171 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6S76_RS02500 | 529255..529854 | - | 600 | WP_020953896.1 | rhomboid family intramembrane serine protease | - |
| P6S76_RS02505 | 529947..530312 | + | 366 | WP_007410229.1 | holo-ACP synthase | - |
| P6S76_RS02510 | 530477..531484 | + | 1008 | WP_007410230.1 | outer membrane lipoprotein carrier protein LolA | - |
| P6S76_RS02515 | 531601..532770 | + | 1170 | WP_007410231.1 | alanine racemase | - |
| P6S76_RS02520 | 532890..533171 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| P6S76_RS02525 | 533177..533527 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| P6S76_RS02530 | 533648..534469 | + | 822 | WP_007410232.1 | STAS domain-containing protein | - |
| P6S76_RS02535 | 534474..534839 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
| P6S76_RS02540 | 534842..535243 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
| P6S76_RS02545 | 535255..536262 | + | 1008 | WP_007410233.1 | PP2C family protein-serine/threonine phosphatase | - |
| P6S76_RS02550 | 536326..536655 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
| P6S76_RS02555 | 536652..537134 | + | 483 | WP_003156173.1 | anti-sigma B factor RsbW | - |
| P6S76_RS02560 | 537100..537888 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
| P6S76_RS02565 | 537888..538490 | + | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T275324 WP_003156187.1 NZ_CP120641:533177-533527 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|