Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 936219..937009 | Replicon | plasmid unnamed1 |
Accession | NZ_CP120639 | ||
Organism | Rhizobium sp. 32-5/1 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | P6U16_RS26185 | Protein ID | WP_277704300.1 |
Coordinates | 936512..937009 (+) | Length | 166 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | - |
Locus tag | P6U16_RS26180 | Protein ID | WP_277704299.1 |
Coordinates | 936219..936515 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6U16_RS26160 (P6U16_26160) | 932503..934040 | + | 1538 | WP_277704297.1 | IS3 family transposase | - |
P6U16_RS26165 (P6U16_26165) | 934265..934393 | - | 129 | WP_277704298.1 | hypothetical protein | - |
P6U16_RS26170 (P6U16_26170) | 934567..935284 | - | 718 | Protein_959 | YafY family protein | - |
P6U16_RS26175 (P6U16_26175) | 935379..935989 | + | 611 | Protein_960 | glutathione S-transferase family protein | - |
P6U16_RS26180 (P6U16_26180) | 936219..936515 | + | 297 | WP_277704299.1 | DUF1778 domain-containing protein | Antitoxin |
P6U16_RS26185 (P6U16_26185) | 936512..937009 | + | 498 | WP_277704300.1 | GNAT family N-acetyltransferase | Toxin |
P6U16_RS26190 (P6U16_26190) | 937770..938249 | - | 480 | WP_277704301.1 | CGNR zinc finger domain-containing protein | - |
P6U16_RS26195 (P6U16_26195) | 938550..939482 | + | 933 | WP_277704302.1 | EamA family transporter | - |
P6U16_RS26200 (P6U16_26200) | 939505..940197 | + | 693 | WP_277704303.1 | DUF72 domain-containing protein | - |
P6U16_RS26205 (P6U16_26205) | 940226..940354 | - | 129 | Protein_966 | IS5/IS1182 family transposase | - |
P6U16_RS26210 (P6U16_26210) | 940475..940819 | - | 345 | Protein_967 | transposase | - |
P6U16_RS26215 (P6U16_26215) | 940892..941239 | - | 348 | WP_277704304.1 | IS66 family insertion sequence element accessory protein TnpB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..1086621 | 1086621 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 166 a.a. Molecular weight: 17704.34 Da Isoelectric Point: 6.7140
>T275323 WP_277704300.1 NZ_CP120639:936512-937009 [Rhizobium sp. 32-5/1]
VSITAPPPLADHHELAEFDSGVSELDDWLCRRARTNQVSGASRTFVVCEGSRVIAYYALASGAVKPPEAPGRLRRNMPDP
IRVAVLGRLAIDRSYQGRGIGRALVRDVGLRLLNAAEILGIRGVLVHAISDEARAFYEAVGFLPSPSDPMMLMIGLGDLN
SALAD
VSITAPPPLADHHELAEFDSGVSELDDWLCRRARTNQVSGASRTFVVCEGSRVIAYYALASGAVKPPEAPGRLRRNMPDP
IRVAVLGRLAIDRSYQGRGIGRALVRDVGLRLLNAAEILGIRGVLVHAISDEARAFYEAVGFLPSPSDPMMLMIGLGDLN
SALAD
Download Length: 498 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|